KEGG   Erwinia billingiae: EbC_08140Help
Entry
EbC_08140         CDS       T01270                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ebi  Erwinia billingiae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ebi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976095..977297
Genome map
AA seq 400 aa AA seqDB search
MKQLTILGSTGSIGTSTLAVVQANPELFAVKALVAGHNVELMAEQCLAFRPAYASMSDEH
SAAALRLRLKSLNVATEVFSGEQAACDLAALDDVDQVMAAIVGAAGLLPTLAAIRAGKQV
LLANKESLVTCGQLFLEAVSASKAQLLPVDSEHNAIFQSLPASLQQQLGYASLEDNGIDS
IILTGSGGPFRDTPLDLLKSMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ATDAQMEVILHPQSVIHSMVRYRDGSVLAQLGSPDMRTPIAHVMAWPQRVPSGAKPLDFT
RMGAMTFAEPDYARYPCLKLAIDACSAGQAATTTLNAANEIAVAAFLDSQIRFTDIAAVN
LAVLEALSCAEPDSVEAVLEIDRQARAVAQAQLSRFSEAR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattgaccatcctcggttcaacgggctctattggcaccagcacgctggccgtc
gtccaggctaatccagagctgtttgccgttaaggcgctggtcgcaggccacaatgttgag
ctgatggctgaacagtgtctggccttccgtccggcctatgcctcaatgtccgatgaacac
tcggcagcggccctgcgacttcgtctgaaaagtttgaatgtggcgaccgaggtgttcagt
ggcgaacaggctgcctgcgatctggccgcgctggatgatgtcgatcaggttatggcggca
atcgtcggtgcggcaggattattgcctacgttagccgcaattcgtgccggaaaacaggtt
cttctggcgaataaagagtcgctcgttacctgcggccagctttttctggaggcggtcagc
gcctcaaaagcgcagctgttacccgtcgacagcgagcacaacgccatttttcagagtttg
cctgcttccctccagcaacagttaggatacgcttctctggaagataatggcattgatagc
attatcctcacggggtcgggtggcccttttcgtgacacgccgttggacctgctcaagagt
atgactcccgatcaggcctgcgcgcatccgaactggtcaatggggcgcaaaatctccgtt
gattccgccaccatgatgaacaaaggtttggaatatatcgaagcccgctggctgtttaat
gcgaccgatgcccagatggaggtcatcctgcatccgcagtcggtgatccactcgatggtg
cgttaccgtgatggcagcgtgctggctcagctgggatcgccggacatgcgcacaccgatt
gcgcatgtgatggcctggccacagcgcgtgccgtccggggcgaagccactggatttcacc
cgcatgggggcgatgactttcgccgagccggattatgctcgctatccctgcctgaagctg
gcaatagacgcctgttctgccggacaggcggcgaccaccacgctgaatgcggccaatgaa
attgcggttgccgcgtttctggattcgcaaattcgctttaccgatattgctgcggtcaat
ttggccgtgctggaggcgctttcctgtgcagaaccggacagcgttgaagcggtgctggag
attgacagacaggcacgagcggttgctcaggcccagctgtcgcgcttctctgaagcccga
taa

DBGET integrated database retrieval system