KEGG   Erwinia billingiae: EbC_12740Help
Entry
EbC_12740         CDS       T01270                                 

Gene name
chb
Definition
Chitobiase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ebi  Erwinia billingiae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EbC_12740 (chb)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EbC_12740 (chb)
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EbC_12740 (chb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1447899..1450553
Genome map
AA seq 884 aa AA seqDB search
MKKFRASLISVALISALASGGAAANQQLVDQISQFGVKYKVTDNLAAQHGVDCAGLGADW
ASCNRATISFTNPGPAIDSKDWAIYMSNVHETLKVESDQFRMVHIVGDLTRLEPTDKFKG
IAAGETIEIPIVNEYWQLFITDVMPRWYATSGDATPKILVSTDTEILTDFVEPFGAQWKR
IADDKNLLMDAQGRFTKNSDVAPMAASTLRGQILPTPLKVSVFSDDADLSAGVTLELASL
SAEKAEAIQQRFALMGIKAQPNGYPITTRVSKKAFDKKLAVPGGYTLNIGKDKAEVVGYD
QSGVFYGLQSILSLIPADGSLNVATLKASDAPRFQYRAVFLDVARNFHSKEVVLRLLDQM
AAWKLNVFHFHLTDDEGWRIEIPGLPELTEIGSKRCHDPEEKRCLLPQLGSGPNSDNSGS
GHFSRQQYIDIVKYADARGIQVIPEIDMPAHARAAVISMEARYDRLFNAGKEKEANEFRL
LDPSDNSNTTSVQLYDRTSYLNPCLSSSLRFTDKVIGEIQAMHKAAGQPLKTWHFGGDEA
KNIRLGSGYSDKNTPVEGTGLLDLSQQDKPWAKSQVCQTMIEEGKIEDLDHLPSDFALNV
SKQVKAHGIGKMQAWQDGIKDAKNAKAFATDRVAVNFWDTLFWGGFDSANDWAGKGYEVI
VSNPDYLYLDFPAEVNPLERGYYWGTRFTDERKIFHFAPDNLPQNAETSVDRDGKPFTAK
SDKPWPGAHGISAQLWSETTRTDAQVEYKLFPRILSVAERAWHRAAWEQDYKAGKEYTGG
KTRLVDQQAQLKDWQRFANLLGQRELAKLDKAGIAYRLPVPGGVVQDGKLVVNTELPGLT
VEYSLDEGTTWQQWQADQPPAVAGKVLLRTRSPDGLRVSRTEAL
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcagagccagtctgatatcggttgcgctgatatctgcgttagccagtggt
ggagcagccgccaaccagcagttagtcgatcaaatcagccagtttggcgtgaagtacaaa
gtgacggacaatcttgccgcccagcatggcgtggattgcgccggactgggcgctgactgg
gcctcctgtaaccgcgcaaccattagcttcaccaatccgggccccgccatcgacagcaaa
gactgggcaatttatatgtctaacgtgcatgaaacgctgaaggtcgaaagcgatcagttt
cgcatggtgcatattgtcggggatttaacccgcctggagccgacagacaaattcaaaggc
attgcggcgggcgaaaccatcgagatcccgatcgtgaatgaatactggcagctgtttatt
accgatgtgatgccgcgttggtatgcgacctctggcgatgccacgccgaaaatcctcgtc
agcacggataccgagatactgaccgattttgtggagccttttggcgctcagtggaagcgc
atcgcagatgataagaacctgttgatggatgcccagggccgctttactaaaaacagcgat
gtcgccccgatggccgcgtccactttacgtgggcaaatccttcccaccccgttgaaggtt
tcggtgttctctgatgacgcggatctctctgctggggtgacgctggaactggcaagcctg
tcggcagagaaagccgaagccatacagcagcgttttgcgctgatgggaatcaaagcgcag
cccaatggatacccgattaccactcgggtgagcaaaaaagcgttcgataaaaagctggcc
gttccggggggatacacgctgaatattggcaaggacaaggctgaagtggtgggttatgac
cagagcggcgtgttctatggtttacagtcgatcctgtcgctgatcccggccgatggcagc
ctgaacgtggcgacgttaaaggccagcgatgcgccgcgtttccaataccgtgcggtgttc
cttgatgtggcgcgcaacttccacagcaaagaggtggtactgcgcttgctggaccagatg
gcggcgtggaaactcaacgttttccatttccatctgaccgacgatgaaggctggcgtatt
gaaattccaggcctgccggagttaacggagattggcagcaagcgttgtcacgatcctgaa
gagaagcgctgtttgctgccacagttaggatcgggaccaaacagtgataacagtggcagc
ggtcatttcagccgtcagcagtatatcgatattgtgaagtatgctgatgcgcgcggtatt
caggtcatcccggaaatcgatatgccggcccacgcccgggcagcggtaatctcgatggaa
gcgcgttacgatcgcttgttcaatgccggtaaggaaaaagaagccaatgaattccgcctg
ctcgatcccagcgacaattccaacaccacctccgtgcagctttacgatcgcaccagctat
ctcaatccgtgcctgagctcctcgttacgctttaccgacaaggtgataggtgaaatccag
gcgatgcataaagctgccggacagccgctgaagacctggcatttcggcggagatgaagcc
aaaaacattcgcttaggatccggctattcggataagaacacacccgttgaaggcaccggt
ttactggacttaagccagcaagataagccgtgggcaaaatcccaggtctgccagacgatg
attgaagaaggaaagattgaagacctggatcatctgccgagcgactttgcccttaacgtc
agcaagcaggttaaggcacacggtatcggcaaaatgcaggcctggcaggatggtattaaa
gacgctaaaaatgccaaagccttcgcaacggacagggttgcggtcaacttctgggatacg
ctgttttggggcggttttgattctgccaatgactgggcaggcaaaggttatgaagtgatc
gtctccaatccggattacctgtatctcgattttcctgccgaggtgaatccgctggagcgg
ggatactactggggaacgcgctttaccgatgaacggaaaattttccacttcgcgccggat
aacttgccacaaaacgccgagacttccgtcgatcgcgacggcaaacctttcacggctaaa
tctgacaagccctggcctggcgctcacggcatctccgctcaactgtggagtgaaaccacc
cgtaccgacgcgcaggtggagtacaagcttttcccgcgcattttgtccgtggcggaacgt
gcctggcaccgcgcagcctgggagcaggattataaagccggcaaagagtataccggcggc
aaaacccgcctggtagaccagcaggctcagctgaaggactggcagcggtttgccaacctt
ctggggcaacgtgaattggcaaaactggataaagccggcattgcctatcgcttgccggtg
cccggtggggtggtgcaggacggtaagctggtggtcaataccgagctaccgggcttaacc
gttgagtacagcctggacgaggggacaacctggcagcagtggcaggcggatcaaccgccg
gcggtggccggtaaggtattgctgcgtacgcgcagtcctgatggtctgcgcgtcagccgg
acggaagcgctgtaa

DBGET integrated database retrieval system