KEGG   Erwinia billingiae: EbC_12960Help
Entry
EbC_12960         CDS       T01270                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ebi  Erwinia billingiae
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_12960 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EbC_12960 (sdhD)
   00650 Butanoate metabolism
    EbC_12960 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EbC_12960 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469657..1470004
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRAAAMIMTLYVIYILGFVVMSGTLTYDIWRGFFASNFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPVAIRLMLQLVVVVALFVYAIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcattgggtcgcaacggcgttcatgactggctgctgctgcgt
gctgctgcgatgatcatgacgttatacgtgatctacatcctcggtttcgtggtgatgtca
ggaaccctgacgtacgacatctggcgtggcttctttgcctccaactttaccaaagtcttc
acccttctgacgctgttctccattctggtgcatggctggattgggatgtggcaggtactg
acggattacatcaagccggttgctatccgcttgatgctgcaactggtggtggtggttgcg
ctgtttgtttatgccatttatggaactgttgttgtgtggggtgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system