KEGG   Erwinia billingiae: EbC_13000Help
Entry
EbC_13000         CDS       T01270                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ebi  Erwinia billingiae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_13000 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EbC_13000 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EbC_13000 (sucB)
Enzymes [BR:ebi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EbC_13000 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475593..1476816
Genome map
AA seq 407 aa AA seqDB search
MSSVEIIVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVILEVPATADGVLEAI
LEDEGATVISRQALGRLKEGNSGGKASSAKVEEQDSTPAQRQSASLEEESNDALSPAIRR
LIAEHNLDAAAIKGTGVGGRLTREDVEKHLAKKPEAAAKAPAAAAPSAPAAALPGRSEKR
VPMTRLRKRIAERLLEAKNSTAMLTTFNEVNMQPIMNLRKQYGEAFEKRHGVRLGFMSFY
LKAVVEALKRFPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDIDALGMADIEKK
IKELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGKESVSYLVAIKELLEDPSRLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagagatcatcgttcccgacctgcctgaatccgttgccgatgccaccgtg
gcaacctggcacaaaaaaccaggcgattctgtccagcgcgacgaagtgctggtagagatc
gaaaccgacaaagtgattctggaagttccggccaccgccgatggcgtgctggaagcgatt
ctggaagatgaaggcgcaacagttatctctcgtcaggcgctgggtcgtctgaaagaaggg
aacagcggcggcaaagcaagctctgccaaagttgaagagcaggattctaccccggcacag
cgtcagagcgcttctctggaagaagagagcaacgacgcgctcagcccggctatccgccgc
ctgattgctgaacacaacctcgatgcggccgccatcaaaggcaccggtgtcggtggacgt
ttgacgcgtgaagacgttgaaaaacatctggcgaaaaaacctgaagccgccgcgaaagcg
cctgctgcagccgcgccttctgcaccagccgccgctctgccaggccgcagcgagaagcgc
gttccaatgacccgtctgcgtaagcgcattgccgagcgtctgttggaagccaaaaacagc
accgcgatgttgaccacctttaacgaagtcaacatgcagccaatcatgaacctgcgtaag
cagtacggcgaagcgtttgaaaaacgtcacggcgtgcgtctgggcttcatgtccttctac
ctgaaagcggttgttgaagcgctgaaacgcttcccggaagtcaatgcgtctatcgacggc
gaagacgttgtttaccacaactactttgacgtcagcatcgctgtttctaccccacgtggg
ctggtcacgccagtgctgaaagatatcgatgcgctgggtatggccgatatcgagaagaaa
atcaaagagctggcagtgaaaggccgtgacgggaaactaaccgttgacgaactgactggc
ggtaacttcaccatcaccaacggcggcgtgttcggttccctgatgtccacgccgatcatc
aacccaccgcagagtgccatcctcggcatgcatgcgatcaaagatcgtcctatggcggtt
aatggtcaggttgtgatcctgccaatgatgtatctggccctctcttacgatcaccgcctg
atcgacggtaaagaatccgtcagctacctggtggcgatcaaagagctgctggaagatccg
tcaaggctgctgctggacgtttaa

DBGET integrated database retrieval system