KEGG   Erwinia billingiae: EbC_13010Help
Entry
EbC_13010         CDS       T01270                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ebi  Erwinia billingiae
Pathway
ebi00020  Citrate cycle (TCA cycle)
ebi00640  Propanoate metabolism
ebi00660  C5-Branched dibasic acid metabolism
ebi01100  Metabolic pathways
ebi01110  Biosynthesis of secondary metabolites
ebi01120  Microbial metabolism in diverse environments
ebi01130  Biosynthesis of antibiotics
ebi01200  Carbon metabolism
Module
ebi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EbC_13010 (sucC)
   00640 Propanoate metabolism
    EbC_13010 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EbC_13010 (sucC)
Enzymes [BR:ebi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EbC_13010 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAX58832
UniProt: D8MPS5
Position
1476924..1478090
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLTTYQTDANGQPVNQILVEAATDIDQELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPHLIHQMALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLICLDGKLTADGNALFRQPELREMRDPSQEDA
REAQAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLSGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLSDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaggcaaaacagttgtttgcacggtatggtttaccggcacca
accggctatgcctgcaccactccacgtgaagctgaagaagccgcctcaaagattggcgcc
ggtccgtgggtagtgaaatgtcaggttcatgccggaggccgcggtaaagcgggcggtgtg
aaggtagtgaagagcaaggaagagatccgtgctttcgctgaacactggctgggcaaacgc
ctgaccacctatcagactgacgccaatggccagccggtaaaccagatcctggttgaagcg
gcaacggatatcgaccaggaactctacctgggtgccgtggttgaccgtgcgacccgtcgc
gtggtgtttatggcctcgaccgaaggcggcgtggaaattgagaaagtggcggaagaaacc
ccgcacctgatccaccagatggcgctggatccattgaccggtcctcagccttatcagggc
cgcgagctggccttcaaactgggtctgaccggtaagcaggttggccagttcaccaagatc
tttatgggtctggccacgctgttcctggagcgcgatctggcactggttgagatcaacccg
ctggtgatcaccaaacagggcgatctgatctgcctcgacggcaaactgactgcggatggc
aatgctctgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaggaagatgcc
cgtgaagcgcaggctgcacagtgggaactgaactatgtggcactggaaggcaacatcggt
tgtatggttaacggcgcaggcctggcgatgggtaccatggacatcgttaagctgagcggc
ggccagcctgctaacttccttgacgttggcggcggtgcaaccaaagagcgcgtgaccgaa
gccttcaaaatcatcctgtctgacgacgcggtgaaagcggtatttgtaaacattttcggc
ggcatcgtacgctgcgacctgattgctgatggcatcatcggcgcggttgaagaagtcggt
gttaacgtgccagtggtggtgcgtctggaaggtaacaatgccgagctgggtgccaaaaaa
ctggcagacagcggtctgaacatcattgcagcaaccagcctgagtgacgcggcgcagcgc
gttgttgccgcagcggagggtaaataa

DBGET integrated database retrieval system