KEGG   Erwinia billingiae: EbC_14080Help
Entry
EbC_14080         CDS       T01270                                 

Definition
Agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
ebi  Erwinia billingiae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EbC_14080
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     EbC_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589205..1590167)
Genome map
AA seq 320 aa AA seqDB search
MQPVDNHSFPQPQSGNDMPRFAGRGTMMRLPAADTPAGLDAAFVGIPLDIGTSQRSGTRY
GPRAIRADSVMIRPYNMATGAAPFDSLRVADLGDVPINTYNLHKSVQIIEDYYTGLNAFP
LVPLTLGGDHTLTLPILRALVKKHGPVGLIHVDAHTDTNDDMFGEKIAHGTTFRRAVEEG
LLDLKRVIQIGQRAQGYDAGDFQWGVDRGFRLVPAEKCWYQSMAPLMAEVRAQMGSGPVY
LSYDIDSFDPAWAPGTGTPEVGGLTSIQGLEIVRGCRGLNLIGADLVEVSPPYDISGTTS
QLAANILYEMLCVLPGVKYN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgttgataatcactctttcccgcagccacaaagcggtaacgatatgccgcgt
tttgccggacgtggcaccatgatgcgcctgccggcagccgacacgccggctggactggat
gcggcctttgttggcattcccctggacatcggcacgtcgcagcgctcaggcacccgttat
ggcccgcgcgccattcgggcggactcggtgatgatccggccgtataacatggccaccggc
gcggcgccgtttgattcactgcgggtggctgacctcggcgatgtgccgatcaatacctat
aatctgcataaatccgtacagattatcgaagactactacaccgggctgaacgccttcccg
ctggtgccgcttacgctcggtggcgatcacaccctgacgctgcccattctgcgcgcgctg
gtaaaaaagcacggaccggtaggacttatccatgtcgatgcgcatactgataccaatgac
gacatgtttggcgagaagattgcgcatggcaccaccttccgccgggcggtcgaagaagga
ttactcgatctcaaacgggtgatccagattggtcagcgggcgcagggctatgatgccggc
gattttcagtggggcgtcgaccggggtttccgtctggtacccgctgaaaaatgctggtat
cagtccatggcaccgctgatggcagaggttcgtgcgcagatgggcagcggcccggtttat
ctttcctatgatatcgacagctttgatcccgcctgggcaccgggcaccggcacgccggaa
gtgggcggcttaacctcgattcaggggctggaaattgtgcgcggatgccgcggtctgaac
ctgattggcgctgacctggttgaggtttcacccccttatgatatcagcggcaccacctcg
cagctggcagcaaacattctctacgaaatgctctgtgtgttacccggagtgaaatacaac
tga

DBGET integrated database retrieval system