KEGG   Erwinia billingiae: EbC_18250Help
Entry
EbC_18250         CDS       T01270                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ebi  Erwinia billingiae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ebi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2069498..2070394)
Genome map
AA seq 298 aa AA seqDB search
MSAGNVPLTASSRESWPAPAKLNLFLYITGRRPDGYHNLQTLFQFLDYGDTLTIETNASG
QIGLLTPVVGVKEEDNLVVRAAKLLQQQATLRGTLPAQAGASIAIEKRLPMGGGLGGGSS
DAATVLVALNHQWQTGFTLSELADLGLSLGADVPVFVEGFAAFAEGVGEKLTPVSPAEKW
YLVVHPGVNISTPAVFTDPELIRTTPAREISELLSAEFRNDCEPVVRKRFREVEQLVSWL
LEYAPSRLTGTGACVFAEFDTESAARQVFELTPKAWQSFVARGVNVSPLHRHLSTLLE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaggcaacgttcccctgacggcgagcagccgtgaaagctggccggcgcccgcc
aagctgaatttatttctctacatcacgggccgtcgtcctgacggctaccataatttgcag
acgctgtttcagtttctcgattatggcgacaccctgaccattgaaaccaacgccagcggg
cagatcggcctgctgacgccggtggtcggggtaaaagaggaagataatctggtggtgcgg
gcggcgaagctgttgcagcagcaggcaacattgcgcggaacgctaccggcgcaggccggt
gccagcatcgccattgagaaacgcctgccgatgggcggcgggctgggcggcggctcgtct
gatgcggccacggtgctggtcgcgctgaatcaccagtggcaaaccggcttcacgctgagc
gagctggccgacttgggattatcgctgggcgcggacgttccggtgttcgtggaaggcttc
gctgcttttgctgaaggcgtcggcgaaaaattgactccggtgtcgcctgcagaaaaatgg
tatcttgttgtccaccctggcgtgaacatttccacaccggctgttttcaccgatcctgag
ctgatccgcaccacgccagcccgcgaaatcagtgagttattaagtgctgaattccgtaat
gattgtgaaccagtcgtaagaaaacgttttcgcgaggttgaacagctcgtttcctggctg
ctagaatacgcgccgtcgcgcctgaccgggacaggagcttgtgtgtttgctgaattcgac
accgagtccgctgcccgccaggtgtttgagctaacgccgaaagcgtggcagagctttgtt
gcgcgaggcgttaacgtttcgccgctgcaccgccacctttcgacgttattagagtga

DBGET integrated database retrieval system