KEGG   Erwinia billingiae: EbC_18510Help
Entry
EbC_18510         CDS       T01270                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ebi  Erwinia billingiae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EbC_18510 (glpK)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EbC_18510 (glpK)
Exosome [BR:ebi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EbC_18510 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2097024..2098559
Genome map
AA seq 511 aa AA seqDB search
MARELIIALDEGTSNVKAVAIDARGQVVTKASRPLTVDTPRSGWVEQDGMMLLNASLTVV
SEVIHSVGENRVAALAISNQRETAMGWERATGKPIAPAITWQCSRSSPFCEQLRGDHQDA
LIRSVTGLPIAPLFSASKMRWLLDNTADGAERAANGELCLGTIDAWLLWHFTGGKQFRCD
TSNAARTQLLNLQTGEWDEAMLALFGLPRVALPEIHPSSGLFGTTRGLSGIPDGLPIMAM
VGDSHAALYGHGLGQAGGVKATYGTGSSVMAPLLTPDTSITQLATTVAWHDGERLVYGLE
GNIPHTGDGVAWMAQATGLTDGKGQVLSRALHELPASIDSTLGVYFVPALTGTGAPWWDD
QARGVICGLSRGVTPAHLIRASLEAIAYQIADVITAMRQHPGFHLETLMVDGGPTQNPWL
MQFQADLLGCPVARSSTPELSALGAGLLARRALEQLNDSQLIALLPEHDCWLPDAARYQQ
LNTSWQGWREAVQRTLWQPAGQTHQGEQHEA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctagagagctgatcattgcgctggatgaaggcaccagcaatgttaaagcggtcgcc
attgatgcccgtggacaggtggtgaccaaagcctcgcgcccgctgacggtggacacgcca
cgctcaggctgggtggagcaggacggcatgatgctgctgaacgcctctctgaccgtggtc
agcgaggttatccacagcgttggcgaaaaccgcgtcgcggcgctggcaatcagtaaccaa
cgtgaaacggcgatgggctgggagcgggcgaccgggaaaccgatcgcgccggcaataacc
tggcagtgttcccgctcttcgccattttgcgagcagctcagaggcgatcatcaggacgcg
ttgatccgctcggtgaccggcctgccgattgcgccgctgttttccgcctcaaaaatgcgc
tggctgctggataacaccgcagatggcgcggaaagggcggctaacggtgagctctgcctc
ggcactatcgatgcctggctgctgtggcattttaccggtggcaagcagttccgctgcgat
acctccaacgcggcacgcacccagctgctgaatctgcaaaccggcgagtgggatgaggcg
atgctggcgctgtttggcctgccgcgcgtggccttacccgaaattcatccgtccagcgga
ctgtttggcaccacccgtggcctgagcggaattcccgatggtctgccgattatggcgatg
gtcggcgattcccatgccgcgctctatgggcacgggctggggcaggcgggcggcgtaaaa
gcgacctacggcaccggttcttcggtgatggcgccgttgctgacgccggacaccagtatt
actcagctggcgaccaccgtcgcctggcacgatggcgaacgtctggtgtacgggctggaa
ggcaatattccgcacaccggcgacggcgtggcctggatggcacaggccaccgggctgacc
gacggcaaaggacaggtcctcagccgggcgctgcatgaactgcctgccagcatcgactca
acgctgggcgtttatttcgtgccggcgctgaccggcaccggcgcgccctggtgggacgat
caggcgcgcggggtgatttgcggcctcagtcgtggcgtgacgcctgcccatctgatccgc
gcttcgctggaagccattgcgtaccagattgccgacgtgatcaccgctatgcgtcagcat
cccggcttccatcttgagacgctgatggttgacggcggcccgacgcaaaacccgtggctg
atgcagttccaggccgatctgctgggttgcccggtggcgcgcagcagtacgccagaactg
tcggcgctgggcgcgggactgctggcaaggcgcgcgctggaacagcttaacgacagccag
ctgatcgcgctgttacctgaacacgattgctggctgcctgacgccgcccgctatcagcaa
cttaacaccagttggcaaggctggcgtgaggcggtacagcgcacgctctggcagcctgct
ggccaaacccatcaaggagaacagcatgaagcgtaa

DBGET integrated database retrieval system