KEGG   Erwinia billingiae: EbC_23820Help
Entry
EbC_23820         CDS       T01270                                 

Gene name
trpB
Definition
(RefSeq) Tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ebi  Erwinia billingiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EbC_23820 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_23820 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EbC_23820 (trpB)
Enzymes [BR:ebi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EbC_23820 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2692490..2693680
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQRDPEFQAEFTDLLKNYAGRPTALTL
CKNLTAGTKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ASALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
DTAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILDREGRLPDAVIACVGGGSNAIGMF
ADFIDDASVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRAEYVSITDDEAMDAFKILCRSEGIIPALESSHALAHALKM
MRDAPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccttattaaatccctattttggtgagtttggcggcatgtatgtgccgcaaatcctg
atgccagccctgaatcagctggaagaagcctttgtcagcgcccagcgcgacccggaattt
caggctgaatttaccgacctgctgaaaaactatgccggtcgccctaccgcgctgacgctg
tgtaagaaccttaccgcgggcaccaaaacccgtttatacctgaaacgtgaagatttgctg
cacggtggcgcgcacaagaccaaccaggttttgggacaggcgttgctggccaagcgcatg
ggcaaaaccgaaatcatcgcggagaccggcgccggacagcacggcgttgcttccgcctta
gccagtgcgttacttggtctgaaatgccgcatttatatgggcgccaaggacatcgaacgt
cagtcgcctaacgtcttcagaatgcgtctgatgggtgcagaagtgatcccggtacacagc
ggttcgtcaacgctgaaagatgcctgtaatgaggcgctgcgcgactggtccggcagctat
gataccgcacactatatgcttggcaccgctgcaggcccgcacccgttccccactatcgtt
cgcgaattccagcgcatgattggtgaagagactaaagcgcagatcctcgatcgcgaaggt
cgcctgccggatgcggtgatcgcctgtgtcggtggcggctcgaacgctatcggaatgttt
gctgatttcatcgatgacgcgtcggtcggcttgattggtgtcgagccagccggtcacggt
attgagtctggtgagcacggcgcgccgttaaaacatggccgcgtgggcatctactttggc
atgaagtcgccaatgatgcagaccgaggatggacagattgaagagtcctactccatttct
gcaggcctcgacttcccttcagtcggcccgcagcacgcctatctgaacagcattggtcgt
gcggaatatgtttcgattaccgatgatgaagcgatggatgcctttaaaatcctctgtcgc
agcgaaggtatcatcccggcgctggaatcttcccacgcccttgcccacgccttgaaaatg
atgcgtgacgcgccagagaaagaacagcttctggtggtaaatctttccggacgcggcgat
aaagatatcttcaccgttcatgacattctgaccgctaagggagaaatttaa

DBGET integrated database retrieval system