KEGG   Erwinia billingiae: EbC_23830Help
Entry
EbC_23830         CDS       T01270                                 

Gene name
trpA
Definition
Tryptophan synthase, alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ebi  Erwinia billingiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EbC_23830 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_23830 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EbC_23830 (trpA)
Enzymes [BR:ebi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EbC_23830 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2693680..2694486
Genome map
AA seq 268 aa AA seqDB search
MERYDLLFKRLAEKKEGAFVPFVTLGDPTPELSLQIIDALVEGGADALELGIPFSDPLAD
GPTIQGAALRAFAAGVTPSQCFEMLKTIRQKYPEIPIGLLMYANLVFSNGIDNFYARCEE
VGVDSVLVADVPIEESAPFRQSAMRHNVAPIFICPPNASDDLLREIASHGRGYTYLLSRA
GVTGTESRGVSHSLQHLVDKLHEYHAAPPIQGFGISEPGQVTEALQAGAAGAISGSAVVK
IIEKNHANPPVMLAELKAFVSSLKAATR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttacgacctgctttttaaacgccttgctgagaagaaagaaggtgcgtttgtc
cctttcgtgacgctgggcgatcccacgccggaactctccctgcagatcattgatgcgctg
gtagaaggcggcgcagatgcgctggagttaggcatcccattctcggatccgctggcggat
ggacccacgattcaaggtgcagccctgcgtgccttcgcggccggcgtgacaccgtcacaa
tgctttgaaatgctgaaaaccattcgccagaaatatccggagatcccgattggtctgttg
atgtacgccaacctggtgttctccaacggcatcgataacttctatgcgcgttgcgaagaa
gtgggtgtggattcggtgctggtcgccgacgtgccgattgaagagtctgctccgttccgt
cagtcagccatgcgtcacaacgtagcaccgatctttatctgtccgcctaacgccagtgat
gacctgctgcgtgagattgcttctcatggccgtggctacacctacctgctgtcccgtgcg
ggcgtaaccggcacggaaagccgtggcgtcagccattcgctgcagcatctggtggataaa
ctgcacgagtatcatgccgctcctcccattcagggctttggtatctctgagccaggccag
gtcacagaggcgctgcaggccggtgccgccggtgctatctcgggttctgccgtggtgaag
atcatcgagaaaaaccatgccaacccaccggtgatgctggctgaactgaaggctttcgtc
agctcgctgaaagcggccacgcgttaa

DBGET integrated database retrieval system