KEGG   Erwinia billingiae: EbC_23830Help
Entry
EbC_23830         CDS       T01270                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ebi  Erwinia billingiae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EbC_23830 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_23830 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EbC_23830 (trpA)
Enzymes [BR:ebi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EbC_23830 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2693680..2694486
Genome map
AA seq 268 aa AA seqDB search
MERYDLLFKRLAEKKEGAFVPFVTLGDPTPELSLQIIDALVEGGADALELGIPFSDPLAD
GPTIQGAALRAFAAGVTPSQCFEMLKTIRQKYPEIPIGLLMYANLVFSNGIDNFYARCEE
VGVDSVLVADVPIEESAPFRQSAMRHNVAPIFICPPNASDDLLREIASHGRGYTYLLSRA
GVTGTESRGVSHSLQHLVDKLHEYHAAPPIQGFGISEPGQVTEALQAGAAGAISGSAVVK
IIEKNHANPPVMLAELKAFVSSLKAATR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttacgacctgctttttaaacgccttgctgagaagaaagaaggtgcgtttgtc
cctttcgtgacgctgggcgatcccacgccggaactctccctgcagatcattgatgcgctg
gtagaaggcggcgcagatgcgctggagttaggcatcccattctcggatccgctggcggat
ggacccacgattcaaggtgcagccctgcgtgccttcgcggccggcgtgacaccgtcacaa
tgctttgaaatgctgaaaaccattcgccagaaatatccggagatcccgattggtctgttg
atgtacgccaacctggtgttctccaacggcatcgataacttctatgcgcgttgcgaagaa
gtgggtgtggattcggtgctggtcgccgacgtgccgattgaagagtctgctccgttccgt
cagtcagccatgcgtcacaacgtagcaccgatctttatctgtccgcctaacgccagtgat
gacctgctgcgtgagattgcttctcatggccgtggctacacctacctgctgtcccgtgcg
ggcgtaaccggcacggaaagccgtggcgtcagccattcgctgcagcatctggtggataaa
ctgcacgagtatcatgccgctcctcccattcagggctttggtatctctgagccaggccag
gtcacagaggcgctgcaggccggtgccgccggtgctatctcgggttctgccgtggtgaag
atcatcgagaaaaaccatgccaacccaccggtgatgctggctgaactgaaggctttcgtc
agctcgctgaaagcggccacgcgttaa

DBGET integrated database retrieval system