KEGG   Erwinia billingiae: EbC_24010Help
Entry
EbC_24010         CDS       T01270                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EbC_24010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_24010
   00620 Pyruvate metabolism
    EbC_24010
   00650 Butanoate metabolism
    EbC_24010
  Lipid metabolism
   00071 Fatty acid degradation
    EbC_24010
  Amino acid metabolism
   00350 Tyrosine metabolism
    EbC_24010
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EbC_24010
   00626 Naphthalene degradation
    EbC_24010
Enzymes [BR:ebi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EbC_24010
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EbC_24010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2711696..2714380
Genome map
AA seq 894 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILGTDETFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDAPSVELSNQ
LMHHPEINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSAYDAVRERFASHGGYMLQGSDLKAVQDIILKNGGLNAAIVGQP
AVKIAEMAGINVPPSTKILIGEVQLVDESEPFAHEKLSPTLAMYRAKDFHDAVSKAEKLV
AMGGIGHTSCLYTDQDNERERVNYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQVVSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLQENLPASYNEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLRLSAPGDRTAQKIEKLLAWLEEMKAQLGIPKSIREAGVQEADFLAKVDKLAEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGVEYQEVFANIAEAIEAQPVAVKKVEKKVKK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccgttactaatgttgctgaacttaacgcacttgttgaacgtgttaaaaaagcacag
cgcgaatacgccaacttcactcaagagcaggtcgacaaaattttccgtgccgcagcgtta
gctgcagcagatgcacgcattccactggccaaaatggccgttgcggaatccggtatgggg
atcgttgaagacaaagttatcaaaaaccacttcgcttccgaatacatctataacgcttac
aaagacgaaaaaacctgcggtattctcggtactgatgagaccttcggcaccatcactatc
gctgaacctatcggcctgatctgcggtatcgtgccaacgactaacccaacttctaccgcc
atcttcaaagcgctgatcagcctcaaaacccgtaacggcattatcttctcaccacatcca
agagcgaaagacgcgaccaataaagcggccgatattgtgctgcaggctgctatcgccgcc
ggtgcgccaaaagatatcatcggctggatcgatgccccgtctgttgagctgtcaaaccag
ctgatgcaccacccagagataaacctgatccttgcgaccggtggtccaggcatggttaaa
gcggcctacagctccggtaaaccagcaattggtgtgggtgcaggtaataccccggtagtt
atcgatgaaacggcagatatcaagcgtgctgtggcatctatcctgatgtccaaaaccttc
gataacggcgtaatctgtgcgtctgagcagtccgtcatcgtggtcgactccgcttatgac
gcggttcgcgagcgtttcgccagccacggcggctacatgctgcagggcagcgatttaaaa
gctgtgcaggatatcatcctgaaaaacggtgggctgaatgccgctatcgtgggccagcca
gcggtgaaaattgccgagatggccggcatcaacgtgcctccaagcaccaagattctgatt
ggcgaagtgcagctggttgatgaatccgagcccttcgcccatgaaaaactctctcctacc
cttgccatgtaccgtgcgaaagatttccacgatgcggttagcaaagcggaaaaactggtc
gctatgggcggtatcggtcacacctcttgtctgtacaccgaccaggataacgagcgtgag
cgtgttaactacttcggcgacaaaatgaagaccgcacgtatcctgattaacaccccggct
tcacagggtggtatcggtgacctgtacaactttaaactggcgccgtctctgacgctgggc
tgtggttcctggggtggtaactccatttctgaaaacgtcggacctaaacatctgatcaac
aagaaaaccgtggctaagcgagcagagaatatgttgtggcataaacttcctaagtctatc
tacttccgtcgcggctcattgcctatcgctcttgaagaagtggcgaccgatggagcaaaa
cgcgcctttatcgtcactgaccgctatctgttcaacaacggttacgctgatcaggtggtg
tcagtgctgaaatctcacggcattgaaactgaagtgttcttcgaagtagaagctgaccca
acgctgagcattgtgcgtaaaggggctgagcagatgaactccttcaaacctgatgtgatt
atcgccctgggcggcggttcaccgatggacgccgcgaaaatcatgtgggtgatgtacgaa
catccggaaacccactttgaagaactggcgctgcgctttatggatatccgtaaacgcatc
tacaaattcccgaaaatgggcgtgaaagcaaaaatgattgctatcactaccacctccggt
accggttcagaagtgacaccatttgcggtagtgaccgacgatgcgactggccagaaatat
ccgctggctgactatgcgctgaccccggacatggcgattgtcgatgccaacctggtgatg
aacatgcctaagtcactctgtgccttcggcggtctggatgcggttacccactctctggaa
gcctatgtgtctgtgctggccaatgagtactctgatggtcaggcgctgcaagcgctgaaa
ctgttgcaggagaacctgccggccagttacaacgaaggcgctaaaaacccggtagcccgt
gagcgtgtgcacaatgctgccaccatcgccggtatcgcgtttgccaacgccttccttggg
gtttgccactcaatggcccacaaactgggttcagagttccatattccacacggtctggct
aacgccctgctgatttgtaacgttatccgctataacgctaacgataacccaaccaaacag
acagcattcagtcagtacgatcgtccgcaggctcgtcgtcgttatgccgaagtggctgac
catctgcgtctgagcgcacctggtgaccgtacggcgcagaaaattgagaaactgctggcc
tggctggaagagatgaaagcgcaactgggtatccctaaatcaatccgcgaggctggcgta
caggaagctgatttcctggcgaaagtcgataagctggctgaagatgccttcgatgaccag
tgtaccggtgctaacccacgctatccgctgattgctgagctaaaacaaatcatgctggat
actttctacggcgttgagtaccaggaagtgtttgccaacatcgccgaagcgattgaagcc
caaccggtcgcggttaagaaagtcgaaaagaaagtgaaaaagtaa

DBGET integrated database retrieval system