KEGG   Erwinia billingiae: EbC_24180Help
Entry
EbC_24180         CDS       T01270                                 

Gene name
pncA
Definition
Pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ebi  Erwinia billingiae
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ebi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2731972..2732589
Genome map
AA seq 205 aa AA seqDB search
MMATRQALLLIDLQNDFCSGGALAVKDGDDTLAIANLYAAEFSQRQQPVVATIDWHPASH
GSFASNAGHQPWTEGELAGLPQVWWPDHCIQHSYGAELHPALEQRYITERVYKGDDPLID
SYSGFFDNGRRKKTRLDSVLKAQGITALTVMGLATDYCVKYSVLDALALGYTVTVLSAGC
RGVNLAAGDAERALEEMATKGAIVL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatggctacccggcaggctctgcttctgattgatttacagaatgacttctgcagcggt
ggcgcgctggcggtgaaggatggtgatgacaccctcgcgattgccaacctgtatgcggca
gagttcagccagcgacagcagcctgtggtagccacgattgactggcaccccgccagtcac
ggcagctttgcgtcgaacgcaggacaccaaccctggaccgaaggcgaactggcgggattg
ccgcaggtctggtggcccgatcattgtatccagcacagctatggtgcggagctacatcca
gcgctggagcaacgctatatcactgagcgtgtctacaagggtgacgatcctctgatagac
agttacagtggcttttttgataacggccggcgcaagaaaacgcgtctggatagcgtatta
aaagcgcaggggattactgcattgaccgtgatggggctggcgacggattactgcgtgaag
tacagcgtgctggacgcgctcgcgctgggctataccgtcacggtgctctctgccggctgt
cggggagtaaatctggccgcaggcgacgctgaacgcgctctggaagaaatggcgaccaaa
ggggcgatcgttctttaa

DBGET integrated database retrieval system