KEGG   Erwinia billingiae: EbC_25090Help
Entry
EbC_25090         CDS       T01270                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ebi  Erwinia billingiae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2825921..2826538)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPLVLLEANGVGYEVHMPMTCFYELPELNQEAILFTHFVVREDAQLL
FGFNSKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAVEREEIAALVKLPGVGKKT
AERLVVEMKDRFKGMHGDLFAADAPFALTSEVQPADAANDAEGEAVAALVSLGYKPQEAS
RMISKLGRPDADCETLIREALRAAI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgtcttagaggcattattttagaaaaacagccgccgttagtgctgctggaa
gccaatggcgtaggctacgaagtgcatatgccgatgacctgtttttatgagctgcctgaa
ctgaatcaagaagccatcctgttcacccactttgtggtacgcgaagatgcgcagctgctg
tttggttttaacagcaagcaggagcgtgcgctgttccgcgagctgatcaaagtgaacggt
gtcggaccgaagctggcgctggccattctgtccggcatgtcggcgcaacagtttgtcacc
gccgtcgagcgcgaagagattgcggcgctggttaagctgccaggcgtgggcaagaaaacc
gccgagcgtctggtggtcgaaatgaaggaccgctttaaaggcatgcatggcgacctgttc
gccgccgatgcgccatttgcgctgaccagcgaagtgcagcctgcggatgccgccaacgat
gccgaaggcgaagccgttgctgcgctggtctcgctggggtataaacctcaggaagccagc
cggatgatcagcaaactgggtcgtccggacgctgattgtgaaacgctgatccgcgaagca
ctccgcgccgcaatttga

DBGET integrated database retrieval system