KEGG   Erwinia billingiae: EbC_25090Help
Entry
EbC_25090         CDS       T01270                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction ATP-dependent DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ebi  Erwinia billingiae
Pathway
ebi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EbC_25090 (ruvA)
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EbC_25090 (ruvA)
DNA repair and recombination proteins [BR:ebi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EbC_25090 (ruvA)
    RecFOR pathway proteins
     EbC_25090 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_2 HHH_8 Transposase_20 Cdd1
Motif
Other DBs
NCBI-ProteinID: CAX60040
UniProt: D8MT83
Position
complement(2825921..2826538)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPLVLLEANGVGYEVHMPMTCFYELPELNQEAILFTHFVVREDAQLL
FGFNSKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAVEREEIAALVKLPGVGKKT
AERLVVEMKDRFKGMHGDLFAADAPFALTSEVQPADAANDAEGEAVAALVSLGYKPQEAS
RMISKLGRPDADCETLIREALRAAI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgtcttagaggcattattttagaaaaacagccgccgttagtgctgctggaa
gccaatggcgtaggctacgaagtgcatatgccgatgacctgtttttatgagctgcctgaa
ctgaatcaagaagccatcctgttcacccactttgtggtacgcgaagatgcgcagctgctg
tttggttttaacagcaagcaggagcgtgcgctgttccgcgagctgatcaaagtgaacggt
gtcggaccgaagctggcgctggccattctgtccggcatgtcggcgcaacagtttgtcacc
gccgtcgagcgcgaagagattgcggcgctggttaagctgccaggcgtgggcaagaaaacc
gccgagcgtctggtggtcgaaatgaaggaccgctttaaaggcatgcatggcgacctgttc
gccgccgatgcgccatttgcgctgaccagcgaagtgcagcctgcggatgccgccaacgat
gccgaaggcgaagccgttgctgcgctggtctcgctggggtataaacctcaggaagccagc
cggatgatcagcaaactgggtcgtccggacgctgattgtgaaacgctgatccgcgaagca
ctccgcgccgcaatttga

DBGET integrated database retrieval system