KEGG   Erwinia billingiae: EbC_27270Help
Entry
EbC_27270         CDS       T01270                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ebi  Erwinia billingiae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    EbC_27270
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EbC_27270
Enzymes [BR:ebi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EbC_27270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3056781..3057209
Genome map
AA seq 142 aa AA seqDB search
MADYAGKLVLVVNTASHCGFTPQYAGLEALNKKYTAQGLVVLGFPCNQFGKQEPGGADEI
AQTCHINYGVSFPMFGKVEVNGANSHPVFRYLKDALPGVLGGRIKWNFTKFLIGRDGKPL
KRFAPFTKPEKMESVIVAALEL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggccgactatgcgggcaagctggtgctggtagtgaataccgccagtcactgcggcttc
acgccgcaatacgcagggcttgaggcgctaaacaagaagtacaccgcccagggactggtg
gtgctgggtttcccctgcaaccagttcggtaaacaggaacccggcggtgccgacgaaatc
gcgcagacctgtcacatcaactatggcgtgagcttcccgatgttcgggaaagtggaggtc
aacggcgccaatagtcaccctgtatttcgctacctgaaagacgcattgcccggcgtgctg
ggtggacggatcaagtggaacttcaccaagttcctgattggacgcgacggcaaaccgctc
aagcgtttcgccccgttcaccaaacccgagaaaatggaatccgtcattgtggctgcgctt
gaactttaa

DBGET integrated database retrieval system