KEGG   Erwinia billingiae: EbC_27330Help
Entry
EbC_27330         CDS       T01270                                 

Definition
arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ebi  Erwinia billingiae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ebi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3062743..3063660
Genome map
AA seq 305 aa AA seqDB search
MEKIILVPSSLGLNPLYEGHIPGTFRAPAVLMHHGLDKIFSFCNFVTVPCPEYSPECESG
TDILNGHKLRQLNLQLADEVEAAHHRNLKPVVIGGDCAILPGALLGSRRHLGQLALVHID
GHSDFRHPGNWKREPGARPGAAAGMDLALVTGRGEPLLTAWPGIEGSLIQDDAVIQLGER
ESLLEDYEWPDIVGTDIRRITIFDALKLPDHHLINVIFERLNLFPEMPYWIHLDMDVLDS
SEMSAVDCPGNPGLSSETLVNVCRELFRNMRCCGITVTIYDPDLDHEGTAAKLILDMLRS
ITNDI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataattcttgtgccgtctagtcttggtctcaaccctctttatgaagggcac
ataccgggcacattccgcgcgccagcagttctcatgcaccacggactcgataaaatattt
tccttttgtaactttgttactgttccctgccctgaatacagtcctgaatgtgagtcaggt
actgatatcctgaacggtcacaagctcagacaacttaatctacaattggctgatgaagtt
gaggcggcgcatcatcgcaacttaaagcccgttgttatcggaggcgactgcgccatactg
cccggagccttactgggcagcaggcgtcatttagggcaacttgcacttgtgcatattgac
ggccacagcgatttccgtcatcccggaaactggaagcgagaaccaggagcacgaccaggc
gctgcggccggaatggatttggcactcgttaccggtcggggagagccattgctgactgca
tggcccggtatcgaaggatcactgattcaggatgacgcagtgattcagctgggagagcgt
gagtcgctccttgaagattatgaatggcctgacattgttggcactgatatccgacgtata
actatctttgacgcgcttaagttgcctgatcatcatctcatcaatgtgatattcgagcgg
ctcaacctttttcctgaaatgccctactggattcatcttgatatggatgtcctggacagt
tctgaaatgtctgcagttgattgtcccggcaatcccggtttgtcttctgaaacacttgta
aatgtctgtcgcgaacttttcagaaatatgcgctgctgtggcatcacagtgaccatttat
gatccagatttagatcatgaaggtacagcagcaaagctcattttggacatgctcagaagc
ataactaacgatatctga

DBGET integrated database retrieval system