KEGG   Erwinia billingiae: EbC_29300Help
Entry
EbC_29300         CDS       T01270                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ebi  Erwinia billingiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EbC_29300 (galF)
   00052 Galactose metabolism
    EbC_29300 (galF)
   00500 Starch and sucrose metabolism
    EbC_29300 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EbC_29300 (galF)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EbC_29300 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3261668..3262564)
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLANSILCARPM
LHDEAFVVVLPDILLDDSTADPLRYNLAAMVAQFEETKRSQVLVHHMPAADLSEYSVIKT
KETLDHPGQVSQIVDFVEKPEHPQALDSDLAAVGRYVLSADIWTELENLEPGAWGRYQLT
DAIANLAKKQPVDAHQLSGTSFDCGRKLGYMKAFVSWGLRNNAQGREFRESIKAILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagttatccccgttgcgggtctgggtatgcacatgctccctgct
acaaaagccattcctaaagaaatgttgccaatcgtcgacaagccgatgattcagtacatc
atcgatgagtgcgttgcagcagggatcaaggaaattgtactggtcacccacgcgtccaag
aatgcggttgaaaaccattttgacacttcctacgaactggaagcgctgctggaagcccgc
gttaagcgttcgcttctgagcgaagtaaaatcgatctgtcctccgggcgtaacgattatg
aacgtgcgccagccacagccgctgggcctggctaactccatcctgtgcgcgcgtccgatg
ctgcacgatgaagctttcgtggttgtgctgccagacatcctgttggatgactcaacagcc
gatcccctgcgttacaacttggccgcaatggttgcgcagtttgaagagaccaaacgcagc
caggttctggttcaccatatgccagcagccgatctgtctgagtactcggttattaaaacc
aaagagacgctggatcacccaggacaggtcagccagattgtcgacttcgttgaaaaacca
gaacatccacaggcgctggattccgatctggccgcggtaggccgttacgtgctgtccgcg
gatatctggaccgagctggaaaacctggagccaggtgcatggggacgttaccagctgacc
gacgccatcgctaacctcgctaaaaagcagcctgttgatgcgcatcagctttccggcacc
agctttgactgcggccgtaaactgggatatatgaaagccttcgtatcctggggtctgaga
aacaatgcgcagggacgtgagttccgcgaatcaatcaaagcaatcctggcgaagtaa

DBGET integrated database retrieval system