KEGG   Erwinia billingiae: EbC_29870Help
Entry
EbC_29870         CDS       T01270                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ebi  Erwinia billingiae
Pathway
ebi00790  Folate biosynthesis
ebi01100  Metabolic pathways
Module
ebi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EbC_29870
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EbC_29870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAX60518
UniProt: D8MUL1
Position
complement(3335036..3335701)
Genome map
AA seq 221 aa AA seqDB search
MAALSQEAALVHQALLARGLETPLRPPAREMDDESRKRLIAGHMTEIMQLLNLDLEDDSL
AETPHRIAKMYVDEVFSGLDYGNFPKITVIQNKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDTVIGLSKINRIVQFFSSRPQVQERLTQQILVALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttaagtcaggaagccgcactcgttcaccaggcgctgttagcccgtggactg
gaaaccccgttacgcccacctgcgcgtgaaatggatgacgaaagccgtaaacgtctgatt
gccggtcatatgaccgagatcatgcaactgctcaacctcgatctggaagacgacagcctg
gccgaaacaccgcaccgcatcgccaagatgtatgtggatgaagtgttttcgggtctggat
tacggcaacttcccgaaaattaccgtcatccagaataagatgaaggtggatgagatggtg
acagtgcgtgacatcacgctgaccagcacctgcgaacaccactttgtgatcatcgatggt
aaggcgaccgtggcctatatcccgaaagacacggtgattggcctgtcgaagatcaaccgc
atcgtgcagttcttctcgtcacgtccgcaggttcaggagcgtctgacgcagcaaattctg
gtggcactgcaaaccctgctgggcaccaataatgtcgcggtctccatcgatgccgtgcat
tactgcgtgaaggcgcgtggcatccgtgatgcgaccagcgccaccacgaccacctcgctg
ggcggattgttcaaatccagccagaatacccgccaggaattcttgcgtgcggtacgtcat
agctaa

DBGET integrated database retrieval system