KEGG   Erwinia billingiae: EbC_31380Help
Entry
EbC_31380         CDS       T01270                                 

Gene name
fadJ
Definition
fatty acid oxidation complex enoyl-CoA hydratase/3-hydroxybutyryl-CoA epimerase/3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ebi  Erwinia billingiae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_31380 (fadJ)
   01212 Fatty acid metabolism
    EbC_31380 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EbC_31380 (fadJ)
   00650 Butanoate metabolism
    EbC_31380 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EbC_31380 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EbC_31380 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EbC_31380 (fadJ)
   00310 Lysine degradation
    EbC_31380 (fadJ)
   00380 Tryptophan metabolism
    EbC_31380 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EbC_31380 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EbC_31380 (fadJ)
   00281 Geraniol degradation
    EbC_31380 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EbC_31380 (fadJ)
Enzymes [BR:ebi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EbC_31380 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EbC_31380 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EbC_31380 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3516293..3518467)
Genome map
AA seq 724 aa AA seqDB search
MMTHNPEKASAFSLVMRLDNVGVITIDVPGEKMNTLKAEFAVQIREVIAQARANSHLAGL
VLISGKPDSFIAGADISMIDRCKTAQEAEALAHEGQKVMAEIASLSVPVVAAIHGACLGG
GLELALACNQRVCSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGASRALDLILTGKTLR
AKQAVKMGLVEDAVPQAILLETAVKMALNGRKPRKTLPLRERLLNAPAGRALLFAMATRQ
TEAKTKGNYPATRKILSVVKTGLLKGSIIGYAAEAKAFGELAMTPESQALRSIFFATTEM
KKDRGADASPRELKAIGVLGGGLMGGGIAYVTATRGKLPVRIKDIKPEGINHAMKYSWDL
LSKSVQRRHLRPAERQQQMALIGGGTDYQGFHHRDVIIEAVFEDLTLKQIMVAEVEANTS
GQTIFASNTSSLPIADIAANASRPENVIGLHYFSPVDKMPLVEVIPHTTTSAETIATVVS
LAKKQGKTPIVVADRAGFYVNRILAPYIIEAMRCLLEGEPIDSIDRALVKFGFPVGPIQL
LDEVGIDVGTHIMPVLEQAWGERFNTPDAFAAVLNDDRKGRKNGRGFYLYNRKTFSRKKS
VDESIYKLLKLDPKSHLSADSVAERCVMMMLNEAARTLDEGVIHSARDGDIGAVFGIGFP
PFLGGPFRYMDRLGAADVVNTLERLMQSHGERFAPCEALKRRAASGERFYKTAEKSNSHA
DSGG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgcacaacccagaaaaagcctcggcattcagcctggtgatgcggctggataac
gtcggggtaatcaccattgatgtgcctggcgaaaagatgaatacgctgaaggcggagttt
gccgttcagatccgggaggtgatcgcccaggcgcgcgctaattcgcacctcgcgggactg
gtgctgatttccggcaaaccggactcgtttattgccggtgcggacatctcgatgatcgac
cgctgcaaaacggcgcaggaagcagaagcgctggcgcatgaaggacagaaggtgatggcc
gaaattgcctcgctttccgtgccggtagttgctgcgattcatggcgcctgcctcggcggt
gggctggagttggcactggcctgcaatcaacgcgtgtgttcgctggatgataaaacccgg
ctcgggctgccagaagtgcagttaggtttgctgccgggctccggcggtacacagcgactg
ccgcgactgattggcgcatcgagagcgctggatctgatcctcaccggcaaaaccctgcgg
gcaaagcaggccgtcaaaatggggctggtggaagacgccgtgccgcaggctattctgttg
gaaacggcggtgaagatggccctgaacggccgtaagccgcgaaaaaccttaccgctgcgc
gagcggctgctgaatgctccggcagggcgcgcgttgctgtttgccatggcgaccagacag
acggaagccaaaaccaaaggcaattacccggccacccggaaaatattgtcggtggtgaaa
accggcctgctgaagggcagtattatcggctatgccgcagaagccaaagcctttggcgag
ctggcgatgacgccggaatcacaggcgttacggtcgattttcttcgccaccaccgagatg
aaaaaggatcgcggtgcggatgccagcccgcgtgaactgaaagcgattggcgtgctgggt
ggcggcttaatgggcggcggcattgcctatgtcaccgcaacgcgtggcaagttgccggtg
cgcatcaaagacattaagccggaaggcattaatcatgcgatgaaatacagctgggatttg
ctgagcaaaagcgtgcagcgtcggcatctgcgcccggcagagcgccagcaacaaatggcc
ctgattggcggcggcaccgactaccagggcttccatcatcgtgacgtgatcattgaagcg
gtgttcgaagacctgacgctgaagcaaatcatggtggcagaggttgaagccaatacttcg
ggccagacgatttttgcctccaatacctcctcgctgccgattgctgatattgcagctaac
gccagccggccggaaaacgtcatcggcctgcactatttcagcccggtagacaaaatgccg
ttggtcgaagtgatcccgcataccaccacctcggccgaaaccatcgccaccgtggtttcg
ctggcgaaaaagcaggggaaaacgccgattgtggtggccgaccgggccggattttatgtt
aaccgcatcctggcaccgtacattattgaagccatgcgctgtttgctggaaggagagccg
atcgacagcatcgatcgggcgctggtgaagttcggtttcccggtcgggccaatccagtta
ctggatgaagtgggcatcgacgtcggcacgcacattatgccggtgctggaacaggcctgg
ggcgagcgctttaatacgcctgacgcctttgccgcggtattgaatgatgaccgtaaaggg
cgcaagaatggacgtggcttctatctctacaaccgtaaaaccttcagccgtaaaaagtcg
gttgatgagagtatttataaactgcttaagctagaccccaaaagccatctcagcgccgat
tctgtcgctgagcgctgtgtgatgatgatgctgaacgaagccgcgagaaccctcgacgaa
ggcgtgattcattccgcccgcgatggcgatattggcgcggtgtttggcatcggtttcccg
ccgttcctcggcggcccgttccgctatatggatcgtctgggggcggcggacgtggtcaac
acattagagcggctgatgcagtcacacggcgaacgttttgccccgtgcgaggcgctgaag
cgacgggcagccagcggcgaacgtttttacaaaacggcggaaaaatcgaatagccatgcc
gattcagggggttag

DBGET integrated database retrieval system