KEGG   Erwinia billingiae: EbC_32510Help
Entry
EbC_32510         CDS       T01270                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_32510 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_32510 (glk)
   00052 Galactose metabolism
    EbC_32510 (glk)
   00500 Starch and sucrose metabolism
    EbC_32510 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EbC_32510 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EbC_32510 (glk)
   00524 Butirosin and neomycin biosynthesis
    EbC_32510 (glk)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EbC_32510 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3606305..3607270)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCEVENGALSQAKTFSTADYDSLEAVIRFYLDEQKQEITDGC
IAIACPITDDWVEMTNHDWAFSTSKMKANLGFEHLEIINDFTAVSMAIPMLSADDVMQFG
GGKAVNDKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLRAE
LGHVSAERVLSGAGLVNLYRAIVKSDDRVPENLKPKDVSQRALDDSCTDCRRALAMFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKSSGFRAAFEDKGRFKDYVQNIPVFLIT
HDQPGLLGAGAHLRQTLGSVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtatgctttggtaggtgatgttggcggcacaaatgcccgcctggcactgtgt
gaagtagaaaacggtgccctttcacaagccaaaactttctccacagcagactacgacagc
cttgaagctgtgatccgcttctatcttgacgaacagaagcaggagattaccgacggctgt
atcgctattgcctgtccaatcactgacgactgggtcgagatgaccaaccatgactgggcg
ttctccaccagtaaaatgaaagccaacctcggctttgagcacctggagatcatcaacgac
tttaccgccgtttctatggccatcccgatgctgtccgcagacgatgtgatgcagttcggt
ggcggcaaagcggtcaacgacaagccggttgcggtctacggcgcagggaccggtctgggc
gttgctcacctggttcacgttgataagcgctgggtcagcctgccgggcgagggcggtcac
gtcgatttcgctgctaacagtgaagaagaagacctgatcctcgaagtgctgcgtgcggaa
ctgggccacgtctctgccgagcgcgtgctgtctggtgccggtctggtgaatctgtatcgg
gcgattgttaaatcagatgaccgggtgccggaaaacctgaagccgaaagacgtgtcgcaa
cgtgcgctggatgacagctgcaccgattgccgccgggcactggcgatgttctgcgtgatc
atgggccgctttggtggcaacctggcgctgaaccttggtacctttggcggtgtgtatatc
gccggcggtatcgtgcctcgcttcctggaattctttaaatcgtccggcttccgtgccgcg
tttgaagacaaaggccgctttaaggattacgtgcagaatattccggtattcctgatcact
cacgatcagccaggcctgctgggtgccggtgcgcacctgcgtcagacgctgggcagcgtg
ctgtaa

DBGET integrated database retrieval system