KEGG   Erwinia billingiae: EbC_33100Help
Entry
EbC_33100         CDS       T01270                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_33100 (tpiA)
   01230 Biosynthesis of amino acids
    EbC_33100 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_33100 (tpiA)
   00051 Fructose and mannose metabolism
    EbC_33100 (tpiA)
   00562 Inositol phosphate metabolism
    EbC_33100 (tpiA)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EbC_33100 (tpiA)
Exosome [BR:ebi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EbC_33100 (tpiA)
  Exosomal proteins of bladder cancer cells
   EbC_33100 (tpiA)
  Exosomal proteins of melanoma cells
   EbC_33100 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3672215..3673009)
Genome map
AA seq 264 aa AA seqDB search
MTQPRITLGVSLKMYFSYQQTLAWSQAVAAIARNHPAIISGEVALFVLPAFPALPPVLEA
FAGSNVLVGAQDLCQEDNGAWTGEVSGAMLAEMGCGFAEIGHAERRRYFAEDDRLIAAKL
AASLRNGLTPVLCLGEPEQGTSQEAIAVCRQQLDAYLLTARQQQLSGHIVLAYEPQWAIG
AATSAPDDFIAEVCHGLRAFSGLGEFTFSVIYGGSAGPGLLRRLGHHVDGLFLGRFAHQP
VALASIIDEAAELATSQEAAWQQA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccgcgtataacgctgggcgttagcctgaagatgtatttcagctatcagcag
acgctggcgtggagtcaggcggtcgcggccattgcccgcaaccatccggcaataatcagt
ggtgaggtggcgctgtttgtcctgcccgcgtttcccgcgttgccgccggtgcttgaggca
tttgccggcagcaatgtgctggtcggtgcgcaggatctgtgtcaggaagataacggtgcc
tggaccggtgaagtcagcggcgcgatgctggcggaaatgggctgtggcttcgccgaaatc
ggtcatgccgagcgccgtcgctactttgccgaagacgacaggctgattgccgccaagctg
gccgcttcgctgcgcaatggcctgacgccggtgctctgtctgggggagccagaacagggc
accagtcaggaggcgattgccgtttgtcgtcagcagctggacgcttatctgctgacggcc
cgccagcaacagctttccggccacatcgttctggcctatgaaccgcagtgggcgattggc
gcggccacctccgcgcccgacgattttatcgctgaggtctgccacggcctgcgtgcgttc
agcgggctgggggaattcaccttcagcgtgatttatggcggcagcgcggggccgggctta
ttacgccgtctgggtcaccacgttgacggtttgttccttggacgctttgcccatcagccg
gtggcactggcgtcaattattgatgaagccgccgaactggctacatctcaggaggcagca
tggcaacaggcttaa

DBGET integrated database retrieval system