KEGG   Erwinia billingiae: EbC_35760Help
Entry
EbC_35760         CDS       T01270                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ebi  Erwinia billingiae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ebi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3977651..3979465)
Genome map
AA seq 604 aa AA seqDB search
MQQAGELRLFRSLDIQFARMIASEDHPALMLAAACVSAEAGEGHVCLPLAQFTEQALFDG
RQPELARQLWRAAGEPAWLDLLQNAEAVGDGSTATPLVLHQQRLYLHRMWQSEGEVARFI
GREAAATAFDPQQLRAALDRQFGQQPDDWQKIAAAVAITRQISVISGGPGTGKTTTVAKL
LATLLSLSQETVRIRLAAPTGKAAARLTESLGKALQRLEVSNEEKQRFPAEATTLHRLLG
AVPGSQRMRYHAGNPLHLDLLVVDEASMVDLPMMANLIAALPSQARVIFLGDRDQLASVE
AGAVLGDICRCAETGYSLARAEELSALTGCLIEGREDPQAPPVRDSICLLRKSYRFDASS
GIGQLALAVNAGDTRQVDAVFAADYADIERFTLGSSEAYQHLLTACVAGYRDYLSRLAAG
AQPADVLDAFSRFQLLCALREGPFGVMGLNERIEVSLQKAGLIRRSPGAANKWYPGRPVM
IARNDSALGLFNGDIGIAMLDEEQALKVFFPLPDGSIKAVQPSRLPPHDTAYAMTVHKSQ
GSEFDHTVLVLPNQFTPVLTRELVYTAITRAKLRLTLYAEQNVLNSAVKMRTLRRSGLVE
RLTE
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacaggccggtgaactgcggctgttccgctcgctggatatacagtttgcccgcatg
attgcgtctgaagatcatcctgctttaatgctggccgcggcctgcgtcagcgcggaagcc
ggagaagggcatgtttgcctgcctttggcccagtttaccgaacaggcgttgtttgacggg
cgacagcctgaacttgcccgtcagctgtggcgggcagcgggtgaaccagcgtggctggac
ctgttgcaaaacgctgaggccgtcggtgacggttccacggccacaccgctggttttgcat
cagcagcgtctttacctgcaccgcatgtggcagtctgaaggagaggtggcgcgatttatt
gggcgggaagccgctgcaaccgcattcgacccgcagcagctgcgcgcagcactggatcgg
cagtttggtcagcagccggatgactggcaaaagattgcggctgcggtcgcgatcacccgt
cagatctcggtgatttccggcggaccaggcaccggtaaaaccaccaccgtggccaaactg
ctggccaccttgctctcgctgtcgcaagagacggtacgtatccgtctggccgcgccaacc
ggtaaagccgcggcccgattgaccgaatcgctgggcaaagctctgcagcggctggaggtc
agtaacgaggagaaacagcggttcccggctgaggcgaccacgctgcaccgcctgctcggt
gcggtgcccggcagtcagagaatgcgttatcacgccggtaacccattgcacctcgatctg
ctggtggtggatgaagcgtcgatggtcgatctgccgatgatggctaacctgattgccgcg
ttaccttcgcaggcgcgggtgatcttcctcggtgaccgcgatcagctggcctcggttgaa
gcgggcgcggtattgggcgatatctgccgctgcgctgaaacgggatacagtcttgcacgt
gcagaagagctgagtgccttaacgggctgccttatcgaaggccgggaagacccgcaggcg
ccgccggtgcgtgacagtatttgcctgctgcgcaagagctaccgcttcgatgcctcttca
ggaattggtcagctggcgctggccgtcaatgcgggcgatacgcgccaggtcgatgcagtc
tttgccgctgattacgccgatattgagcgcttcacgttggggagtagcgaagcgtatcag
catctgcttactgcctgtgttgccggataccgcgactatctgagccgccttgcagccggt
gcacagcctgccgatgtgctggatgcgtttagccgtttccagctgctttgcgcgctgcgc
gaagggccgtttggggtgatggggctgaatgaacgcattgaggtctcgctgcaaaaagcg
ggcttgatccgtcgttcaccgggcgcggcgaataaatggtatcccggccggccggtgatg
attgcccgcaacgacagtgcgttggggctgtttaacggcgacattggtattgcgatgctg
gatgaggaacaggcgctgaaggtgttcttcccactgcctgacggcagcatcaaagccgta
cagcccagccgactgccgccgcacgatactgcctatgcgatgacggtgcataaatcgcag
ggatccgaattcgatcacaccgtgctggtgctgcctaatcagttcacgccggtgctgacc
cgcgagctggtttacaccgccatcacccgcgcgaaattacgattaacgctgtatgcggag
caaaacgtgttaaacagcgcggtgaaaatgcgcaccttgaggcgcagcgggctggtcgaa
cggcttaccgaataa

DBGET integrated database retrieval system