KEGG   Erwinia billingiae: EbC_36270Help
Entry
EbC_36270         CDS       T01270                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ebi  Erwinia billingiae
Brite
Enzymes [BR:ebi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EbC_36270 (dsbC)
Secretion system [BR:ebi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EbC_36270 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4044556..4045260)
Genome map
AA seq 234 aa AA seqDB search
MKKPYLVLSLLIAAISGVAHADDAAIQQWLKKLGLQQTEIQPSPLPGMKTVLTESGVLYV
TEDGKQFIQGPLYDVSGGQPVNVTNKLLEKKVEALSEQMIVYKAPKEQHVITVFTDITCG
YCRKLHSQMADYNALGITVRYLAFPREGMNGQVAKNMESVWCAADRKKAFTTAMNGGEVS
PIDCKIDLSQHYKLGILYGIQGTPAILLQNGMMIPGYQGPQEMKQLLDSQKAGG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccttacctggtactttctctgctgatcgccgccattagcggtgtggcacac
gcagacgatgccgccattcagcaatggctgaagaaattgggtctgcagcagactgaaatc
cagccttcccctttgccaggcatgaaaaccgtgctgaccgagagcggcgtgctctacgtg
accgaagacggcaagcagtttattcaggggccgctgtatgatgtcagcggtggccagccg
gtcaacgtcaccaataagctgctggagaagaaagtcgaggcgttgagcgagcagatgatc
gtttacaaagcgccaaaagagcagcatgtgattacggtgttcaccgatatcacctgtggc
tactgccgcaagctgcactcacagatggctgactataacgcgctggggatcaccgtccgt
tacctcgctttcccacgtgaagggatgaatggccaggtggcgaaaaacatggaatccgtc
tggtgtgctgccgatcgtaaaaaggccttcaccaccgcgatgaacggcggcgaagtgtca
ccgattgattgcaaaatcgacctgtctcagcactacaagctggggatcctgtacggcatc
cagggcacgccagccattctgttgcagaacggcatgatgatccctggttatcaggggccg
caggaaatgaaacagctgcttgatagccagaaagcgggtggctaa

DBGET integrated database retrieval system