KEGG   Erwinia billingiae: EbC_37860Help
Entry
EbC_37860         CDS       T01270                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_37860 (pfkA)
   01230 Biosynthesis of amino acids
    EbC_37860 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_37860 (pfkA)
   00030 Pentose phosphate pathway
    EbC_37860 (pfkA)
   00051 Fructose and mannose metabolism
    EbC_37860 (pfkA)
   00052 Galactose metabolism
    EbC_37860 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EbC_37860 (pfkA)
Enzymes [BR:ebi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EbC_37860 (pfkA)
Protein phosphatases and associated proteins [BR:ebi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EbC_37860 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4208082..4209074)
Genome map
AA seq 330 aa AA seqDB search
MKRKIALIASGGDAVGINSAILPLVQHAESVLAFHGGYDGIIHHAPFMLNETEVRLAVAS
NRNVLRSARSQLAWQPAGRASIRRRLRELDVDLLLVFGGGGSLQAARCLQEEGQPVLLIP
MTVDNDIPGLDDTLGFSSAVGVIAQALDQLHGTAHNMPGRIYLLEAFGAGCGHLALSGAL
AGAAHAVLIPEIPPDMHWLQQRLRHCLNAPFGYGIVVCAEGVAGSGRVMAGSQGGAVALG
QQLEATLDVPVRYTLPGYCQRAATPVTADRLLASASGQQALQLFQQGESGLVIGMARGQT
TCIRLQAIAAGKRQPDPHLVVAARNLQMIN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaaaaattgcactgattgccagcggcggagatgccgtagggattaattcggct
attttgccgctggttcagcacgctgaatctgtgctggcgtttcatggtggctatgacggc
attattcatcacgcgccttttatgctgaatgaaaccgaggtcaggctggcggtcgccagc
aaccgtaacgttttacgcagcgcccgcagtcagcttgcctggcagccggcgggaagggcc
agcatccgcaggcggttacgggaacttgacgtcgatctgctgctggtgtttggcggcggc
ggttcgctgcaggcggcaaggtgtttgcaggaagaggggcagccagtcctgctgatcccg
atgacggtagacaatgacatccccggtctggatgacacgctgggctttagcagcgcggtg
ggagtgattgcgcaggcgctggaccagctgcacggtacggcgcacaacatgccggggcgg
atttatctgctggaagcgttcggtgcaggctgtgggcatctggcgctcagcggtgcgttg
gccggcgcggcacatgcggtgttaatcccggagatcccgccggacatgcactggttgcag
cagcgcttacgccactgtctcaacgcgccttttggctacggcatcgtggtgtgtgccgaa
ggcgtggcaggcagcggaagggtaatggcaggaagccagggcggtgcggtggcgttaggg
cagcagcttgaagcgacgctcgatgtgccggtgcgttacaccctgccgggatattgtcag
cgcgcggcgacgcctgtgacagccgaccggttactggcctccgcttccggtcagcaggcc
ttgcagctctttcagcaaggtgaaagcgggctggtgattggcatggcacggggacaaaca
acatgtatcaggctgcaggctatcgcagcaggtaaaagacaacccgatccgcatttagtg
gtagcggcaagaaacttacagatgatcaactaa

DBGET integrated database retrieval system