KEGG   Erwinia billingiae: EbC_39780Help
Entry
EbC_39780         CDS       T01270                                 

Gene name
chb
Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ebi  Erwinia billingiae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ebi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ebi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4439428..4441818)
Genome map
AA seq 796 aa AA seqDB search
MPQFLRLSLLASALFVSLYAQATPAGNLPLMPWPQQVEQPASGGSLRLDNRLSIRIEGDD
LPGSVDRWRQRIGLQTGWQMMPQTAEVAQPTIRIIIAKRVDPIPQPDSDESYSLQVSGDG
VVLNAATRFGAMRGMETVLQLVQNTRQASEIPYVTIHDSPRFPWRGILIDSARHFMPLDT
LRRQIDGIASARMNVFHWHLTDDQGWRFASSHYPQLQEKGSDGLFYTQDQMRSIVQYAAD
RGVRVVPEIDLPGHATALAVAMPELISAPGPYQIERGWGVFKPLLDPSNEQVYQFIDTLV
GEVAAVFPDPWLHIGGDEVDATQWKESKPVQDFMREKGLKDEHALQAYFNQRVEKILEQH
HRQMMGWDEIAHPDLPKSILIQSWQGQDALGEVSKQDYHGILSAGFYLDQAQPASYHYRN
EVYPVGLDGHDRLQQGDTAQSWQFSMPRLKGSAVKGSFTLIEHGGEWRGFIDFAGKSRRM
VRDVEWLSPHQVTFSVDTWMGDFQPVVSLDGDRLSGYMRVGNARYPAQGTKLNAVPIGIQ
PAVPSEQQMKDNLLGGEAALWAEIVNPQVIDVRLWPRAYVVAERLWSAKDVTNEQNMYRR
LAAVDSWSAVSVGLQQHAQTQTQMIRLANSSNTVPLQIFAEALEPAQYYTRQHLKFQAGH
YDLNEPLNRLADVLPAESDKVRELNQQVGALIANRSDRQALQAIRHQLRLWQQNVPEVMP
LLAQNYALQPLQPVAQQLEAISRIGLSLLDAIEDNRAFGSDEVAKMQATLDKAAATQDEV
VLALVYPIERLLRAER
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagtttttgcgtttgtcgttacttgccagcgccctgtttgtctcactctatgct
caggcaacccccgctggcaacctgccgttgatgccctggccacaacaggttgagcagccc
gccagcggcggcagtttgcggctggataaccggctttcgatccgcattgagggcgacgat
ctgccgggatcggtagatcgctggcgtcagcgtattggcctgcaaaccggctggcagatg
atgccgcaaaccgctgaggtggcgcagccgaccatccgcattatcatcgccaaacgcgtc
gatccgatcccgcagccggacagcgatgaaagctacagcctgcaggtcagcggtgacggc
gtggtgctgaatgccgccacgcgttttggtgcgatgcgtggcatggaaaccgtgctgcaa
ctggtgcagaacacccggcaggctagcgagatcccttatgtcactatccacgacagcccg
cgctttccctggcgtggcatcctgatcgattccgcccgtcattttatgccgctcgacaca
ctccgccgccagattgatggcattgcctcggccagaatgaacgtcttccactggcacctg
accgacgatcagggctggcgattcgcctccagtcattatccacagctgcaggaaaagggc
agtgacggcctgttctacacccaggatcagatgagatcgatcgtgcagtacgcagcggat
cgtggcgtacgcgtggtgccggagatcgatcttccgggtcatgcgacggcgctggcagta
gcgatgcccgaattgatcagcgcgccggggccgtatcagatcgaacgtggctggggcgtg
ttcaaaccgctgctcgatcccagcaacgagcaggtttatcagtttatcgacaccctggtc
ggggaagtggcggcggtgttccccgatccgtggctgcatatcggtggcgacgaagtggat
gccacgcagtggaaggaatccaaacctgttcaggactttatgcgggaaaaagggctgaag
gatgagcatgcgctgcaggcgtatttcaaccagcgggtggagaagatccttgagcagcat
catcgccagatgatgggctgggatgagatcgcccatccggatctgccaaaaagcattctg
atccaatcctggcaggggcaggatgcgttgggcgaggtcagcaagcaggattatcacggc
attctctccgccggtttctatctggatcaagcgcagccggcctcttatcactaccgcaac
gaagtctatcccgtgggtctggacgggcacgatcggctgcagcagggcgatacggcgcag
agctggcagttcagcatgccaaggctgaaaggcagcgcggtgaagggcagctttacgctt
atcgagcatggcggcgaatggcgcggctttatcgattttgccgggaaatcgcggcggatg
gtacgcgacgtcgagtggctgtcaccgcatcaagtgactttcagcgtggatacctggatg
ggtgatttccagccggtggtctcgctggatggcgacaggctcagcggctatatgcgggtg
ggcaacgcccgctatcctgctcagggcactaagctgaatgcggtgccgatcggtatccag
cctgcggtacccagtgagcagcagatgaaagataacctgctgggcggcgaagcggcgctg
tgggcagaaatcgtcaatccgcaggtgattgatgtgcgcctgtggccgcgcgcctatgtc
gtcgcggagcgtctgtggtcggcgaaggatgtgaccaatgagcagaacatgtaccggcgg
ctggcggcggtggacagctggtcagccgtctcggtgggcttgcagcagcatgcccagacg
cagacccagatgatccggctggcgaacagcagcaataccgtgccgctgcaaatcttcgcg
gaagcgctggagccggcccagtattacacccgtcagcacctgaaattccaggccggacat
tatgacctgaacgaaccgctaaaccggcttgccgatgtgttacccgctgagagcgataag
gtgcgcgagcttaaccagcaggtcggggcattgattgccaaccggagcgaccgccaggca
ctgcaggctatacgtcatcagctgcgcctgtggcagcaaaacgtgccggaggtaatgccg
ctgctggcgcaaaattatgcgctacagccgcttcagccggtggcgcagcagctggaagcg
ataagccgcatcggcctgtcattgctggatgccattgaggataaccgggcgttcgggtcg
gatgaagtggcaaaaatgcaggcgacgctggataaagcggcggccacccaggatgaagtg
gtgctggcgctggtttatccgattgagcggttattgcgggcggaacggtag

DBGET integrated database retrieval system