KEGG   Erwinia billingiae: EbC_40080Help
Entry
EbC_40080         CDS       T01270                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ebi  Erwinia billingiae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EbC_40080 (folP)
Enzymes [BR:ebi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EbC_40080 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4475819..4476655)
Genome map
AA seq 278 aa AA seqDB search
MKLYARDTILDLSHPHVMGILNVTPDSFSDGGKHNDLVQALTHANEMINAGATIIDIGGE
STRPGASEVSVEQELERVIPVVEAISQRFEVWISVDTSKPEVIRESANAGAHIINDIRSL
QEPGALEAAAATGLPICLMHMQGDPATMQQSPKYKQLLQDVDAFFVQHIARCEAAGIKKE
QLILDPGFGFGKNLSHNYQLLAHLADFHRFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGAHILRVHDVKETVEAMRVVEATLSAKEE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacgccagagacaccatcctcgatctttcccatcctcatgtgatggggatc
ctgaatgtgaccccggattctttctctgatggcggcaagcataacgatttggttcaggcg
ctgacccatgccaacgaaatgatcaatgccggtgccaccatcattgatatcggcggcgaa
tccacgcgtcctggcgcatcggaagtcagtgtagagcaggagctggaacgggttattccg
gtggttgaggctatttctcaacgttttgaagtgtggatttcggtcgatacatcaaaacca
gaggtgatccgggaatcggcaaatgcgggtgcgcacatcatcaatgatatccgttcactg
caggagcccggtgctttggaagcggcggcggcaacgggcctgccgatttgtctgatgcat
atgcagggcgatccggccaccatgcaacaatcgccgaagtacaaacagctgctgcaggat
gtggacgccttttttgtgcagcacatcgccagatgcgaagccgccgggatcaaaaaagag
cagttgatcctcgacccgggattcggtttcggtaagaatctgtcccacaattatcagttg
ctggcccatctggctgattttcaccggttcggcctgccactgctggtcggcatgtcccgt
aaaagtatgattgggcaactgctgaatgttggcccgtcgcagcggctgacaggcagtctg
gcctgcgcggtaatcgccgcgatgcaaggcgcgcacatcctgcgcgttcatgatgttaaa
gaaaccgtcgaagcgatgcgcgtcgtcgaagcaacactgtcagcgaaggaagagtaa

DBGET integrated database retrieval system