KEGG   Erwinia billingiae: EbC_40080Help
Entry
EbC_40080         CDS       T01270                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ebi  Erwinia billingiae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ebi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4475819..4476655)
Genome map
AA seq 278 aa AA seqDB search
MKLYARDTILDLSHPHVMGILNVTPDSFSDGGKHNDLVQALTHANEMINAGATIIDIGGE
STRPGASEVSVEQELERVIPVVEAISQRFEVWISVDTSKPEVIRESANAGAHIINDIRSL
QEPGALEAAAATGLPICLMHMQGDPATMQQSPKYKQLLQDVDAFFVQHIARCEAAGIKKE
QLILDPGFGFGKNLSHNYQLLAHLADFHRFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGAHILRVHDVKETVEAMRVVEATLSAKEE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacgccagagacaccatcctcgatctttcccatcctcatgtgatggggatc
ctgaatgtgaccccggattctttctctgatggcggcaagcataacgatttggttcaggcg
ctgacccatgccaacgaaatgatcaatgccggtgccaccatcattgatatcggcggcgaa
tccacgcgtcctggcgcatcggaagtcagtgtagagcaggagctggaacgggttattccg
gtggttgaggctatttctcaacgttttgaagtgtggatttcggtcgatacatcaaaacca
gaggtgatccgggaatcggcaaatgcgggtgcgcacatcatcaatgatatccgttcactg
caggagcccggtgctttggaagcggcggcggcaacgggcctgccgatttgtctgatgcat
atgcagggcgatccggccaccatgcaacaatcgccgaagtacaaacagctgctgcaggat
gtggacgccttttttgtgcagcacatcgccagatgcgaagccgccgggatcaaaaaagag
cagttgatcctcgacccgggattcggtttcggtaagaatctgtcccacaattatcagttg
ctggcccatctggctgattttcaccggttcggcctgccactgctggtcggcatgtcccgt
aaaagtatgattgggcaactgctgaatgttggcccgtcgcagcggctgacaggcagtctg
gcctgcgcggtaatcgccgcgatgcaaggcgcgcacatcctgcgcgttcatgatgttaaa
gaaaccgtcgaagcgatgcgcgtcgtcgaagcaacactgtcagcgaaggaagagtaa

DBGET integrated database retrieval system