KEGG   Erwinia billingiae: EbC_42080Help
Entry
EbC_42080         CDS       T01270                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ebi  Erwinia billingiae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EbC_42080
Enzymes [BR:ebi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EbC_42080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4666195..4667883
Genome map
AA seq 562 aa AA seqDB search
MDNITPLLDKIYDGTFPLVCREKLADAILRTRNELNHQRKAHWDEKDVVLITYADQFREA
DTPTLRTLSRFYQQHLQSSFTLVHLLPFFPYSSDDGFSVIDYHQVNGICGDWSDIAELHG
QTRLMFDFVCNHMSAHSGWFRHFLAQDPGWDDFFISMPPSTDLSAVTRPRTSPLLTPFQM
ADGQTRFIWTTFSADQIDLNFANPEVLLSMVNVLLDYLAKGADYVRLDAVGYMWKTPGTS
CIHLEKTHLLVKLFRAIANAVAPGTVIITETNVPHKDNISYLGNGQDEAQMVYQFSLPPL
VLHAIHNGSARALKQWAASLDGSGGTTTWFNFLASHDGIGLNPLRGILPETEIVSLVRDL
AMEGALVSYKNNPDGSTSPYEINVTYMDALNKKDDDDSTRLQRFMLAHALLLAFPGVPAL
YIQSILGSRNDMDGVKAAGHNRAINRQKYSLSQIEAELSDTHSLRYRVYHALASLVQLRT
RQTAFHPDNPMQVLEGDNALFVMYRWSEKDHQTLLCIYNLSNREIAYTLPDARRYRDIIT
DRIFDGEKPLTLTPLSYMWLKS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggataacattactcccttactcgacaaaatttacgacggcacctttcccctcgtctgc
agggaaaagttggcggatgctattctgcgcacccgcaacgaactgaatcatcagcgtaaa
gcgcattgggatgaaaaagacgtggtgctgatcacctacgccgatcagttccgcgaggcc
gatacgcccacgctgcgcaccctctcacgcttctatcagcaacatttgcagtccagcttt
acgttggttcacctgctgccctttttcccttattcatcggatgatggcttttcggtgatt
gattaccatcaggtcaacgggatttgcggggactggtcagatatcgccgaactgcacggc
cagacgcgattgatgtttgattttgtctgcaaccatatgtccgcccacagcggatggttc
aggcattttctggcgcaggatccgggctgggatgatttctttatcagcatgccaccgtcc
accgatttgagtgcggtcacgcgtccaagaacctcgcccttactgacgccgtttcagatg
gcggacggtcaaacccgctttatctggaccaccttcagcgccgaccagatcgatctcaat
tttgccaatcctgaagtgctgctgagcatggtcaacgtgctgttggattatctggcaaaa
ggggccgattatgtccggctggatgccgttggctatatgtggaaaacgcccggaacctcc
tgcatccatctggaaaagacccacctgctggtcaaactgtttcgcgccatcgccaatgcc
gtggcgccaggcacggtgatcatcaccgaaaccaacgtgccgcacaaagacaacatcagc
tatttgggcaacggccaggatgaagcgcagatggtgtatcagttttcactgccgccgctg
gtgctacacgccattcacaacggatcggcacgcgcactgaaacagtgggcagcctcactt
gatggctctggcggcacgacgacctggtttaatttcctcgcgtcccacgatggcatcggc
ctgaatccgctccggggcattttgccggaaaccgaaatcgtctcgctggtcagggatttg
gcgatggaaggggcgttggtttcgtataaaaacaatccggatggcagcaccagcccttac
gaaatcaacgtcacgtatatggatgccctgaacaaaaaagacgatgacgacagcacccgg
ctgcaacgatttatgttggcccacgccctgttgctggcgtttcctggcgtgcctgcgctc
tatatccagagcatactgggctcgcgcaacgatatggatggggtgaaagccgccggacat
aaccgggcgattaaccggcagaagtacagcctcagccagattgaagcggaattaagcgat
acccattcgctgcgatatcgggtttatcacgcactcgccagcctggtgcaactcagaacc
cggcaaaccgcctttcatccggataatcccatgcaggtactggaaggtgataacgcgctg
ttcgttatgtatcgctggtccgagaaagatcatcagacgttgctgtgcatatataacctc
agcaaccgggagatcgcatatacgctgccggacgcccgacgctatcgcgatattattacc
gacaggattttcgacggtgagaaaccactgacgttaacgccgctctcttatatgtggctg
aagagctga

DBGET integrated database retrieval system