KEGG   Erwinia billingiae: EbC_42130Help
Entry
EbC_42130         CDS       T01270                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ebi  Erwinia billingiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ebi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4670593..4672701)
Genome map
AA seq 702 aa AA seqDB search
MDKKKFEQEAAAAGIATKYINARGEAEEVSVAIRQRLLAAMSGKHKEKPGPVPACKVFIR
KRLLQLPVGGKGEYQWQLMMENGREHSGTVNGGEAIRLPANLAFGYHQLHLQQAGKQWQC
RIIVAPKRCYEPEPLLQGKKLWGSCVQLYTVRSEQNWGMGDFGDLKRLLAEVADRGGAFI
GLNPIHSLYPANPESASPYSPSSRRWLNVLYIAVAEVPDFQQGKAAQRWWQQKGTQKQLA
KARESDWVDYARVGELKISGLRHAWQHFTQRKNSDPDVVQFEDFIAEGGSSLYWQAAYDA
LHGIMLADNPDRWGWPVWPKTLQQAHSKEVQQFCQQQESEIRFWLWLQWLANRQFDACWQ
LSQQRKMPIGLYRDLAVGVAEGGSETWCDPELYCLGASVGAPPDILGPLGQNWGLPPMDP
HVMAARGYQPFIDLVRANMASCGALRIDHVMSMLRLWWIPYGETANFGAYVYYPVEDLLA
ILALESQRNQCMVIGEDLGTVPKEIVSLLRDGGIYSWKVLYFEQQNMDQYHSPAAWPRQS
MASATTHDLPTLRGFWNAGDLVLGERLGLYPDKVVLHRLYQDRARQKQALLTALHQYGCL
SKSNGKKASVMKMTPELNRGMQRFIADSNSALLGLQPEDWLDMDKPVNVPGTTDQYPNWR
RKLSMTLEEMFADVRVNRLIKDINRRRKAGELSGKSVKKAGE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaagaaatttgaacaggaagccgccgccgccgggatcgccacaaaatacatc
aacgcccgtggtgaggcggaagaggtcagcgtggccatccgtcagcgtctgctggcggcg
atgtcggggaagcacaaagaaaaacccgggccggtaccggcctgcaaagtgtttattcgt
aagcgtttgctgcaactgccggtcggtggaaagggcgaatatcagtggcagctgatgatg
gagaacgggcgggaacacagcggaacggtgaacggtggggaagcgatccggctgccggcc
aatctggccttcggctaccatcagctgcatcttcagcaggctggaaagcagtggcagtgc
cggatcattgtggcccctaagcgctgctatgaacctgagccgttgctgcagggcaaaaaa
ctgtggggatcctgcgttcagctgtataccgtgcgttctgaacagaactggggaatgggg
gatttcggcgatttaaaacgcttgctggcggaagtggccgatcggggtggcgcgtttatc
ggcctgaatccgatccattcgctgtatcccgcgaacccggaaagcgccagcccgtacagt
ccctcgtcccggcgctggctgaacgtgctgtatatcgctgtggctgaggtgccggatttc
cagcagggcaaagcggcgcaacgctggtggcaacaaaaaggcacgcaaaagcagctggcc
aaagcccgtgaaagtgactgggtggattatgcacgggttggcgagctgaaaatcagcggg
ctgcgtcatgcgtggcagcattttacccagcgcaaaaatagcgatcccgacgtggtgcaa
tttgaggattttatcgccgaaggcggtagcagcctctactggcaggcggcttatgatgcg
ctgcacggcattatgctggcggacaaccccgatcgttggggctggcccgtgtggccgaag
accttgcagcaggcccactcgaaagaagtgcagcagttttgccagcagcaggagagtgaa
atccgcttctggctgtggttacagtggctggcaaaccggcagtttgatgcctgctggcag
ctgagccagcagcgcaagatgccgatcggcttataccgtgacctggcggttggcgtggcc
gaaggcggttcggaaacctggtgcgatccggagctgtattgcctcggtgcttccgtcggg
gcgccgccggatattctggggccgctgggtcaaaactgggggctgccaccgatggatcca
cacgttatggcagccagaggctatcagccatttatcgacctggtacgggcgaatatggcc
agctgcggtgcgctgcgcatcgatcatgtgatgtcgatgctgcggctatggtggatcccc
tacggtgaaaccgccaacttcggtgcctatgtttactatccggtggaagacttgctggca
atcctcgcactggagagccagcgcaatcagtgcatggtgattggcgaagatttgggcacg
gtgccgaaggagatcgtctcactgctgcgagatggcggtatctactcctggaaggtgctg
tacttcgagcagcagaatatggaccagtaccattcacccgccgcctggccccgtcagtcg
atggcgagtgccactacccacgacttgccaacgctgcgcggcttctggaatgccggcgat
ctggtattaggggagcggcttgggctctacccggacaaagtggtgctgcaccggctgtat
caggatcgcgccagacagaagcaggctctgctgacggccttgcatcagtatggctgcctg
tctaaaagcaacggcaaaaaagccagcgtgatgaaaatgaccccggagttgaatcgcggg
atgcagcgatttattgccgacagcaacagtgcgctgctgggtctgcaaccggaggactgg
ctggatatggataagccggtcaacgtgcccggaaccaccgatcaatacccgaactggcgc
agaaagctcagcatgacgctggaagagatgtttgccgatgtgcgggttaaccggctgatt
aaggatattaatcgcaggcgcaaggcgggtgagctaagcgggaaatccgttaagaaagcg
ggggagtaa

DBGET integrated database retrieval system