KEGG   Erwinia billingiae: EbC_43980Help
Entry
EbC_43980         CDS       T01270                                 

Gene name
celA
Definition
endoglucanase (endo-1,4-beta-glucanase Y)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ebi  Erwinia billingiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EbC_43980 (celA)
Enzymes [BR:ebi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EbC_43980 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4879997..4880998)
Genome map
AA seq 333 aa AA seqDB search
MMSLLRASLMIIAMMVGCAQATASDGWSTFKGRFMTEDGRIQDTGNNNVSHTEGQGYAML
MAVWYNDRGSFDSLWRWTQQHLKNPQNGLFYWKYNPAAADPVMDKNNASDGDVLIAWALL
KAGQKWQDQAYLQASDRIQKAIVDREVITFGGQTVMLPGVQGFNKTSYVVLNPSYFLFPA
WRDFAARSHLKVWTNLIDSGMDLLGKMRFGDAGLPVDWVALNADGTVAPATAWPPRFSYD
AIRVPLYVYWYDAQSLQLVPFQRYWMSFSRLQTPAWIDVMSNNKAPYNMAGGLLAVRDLT
LNQSGYLTDQLDAKEDYFSSSLHLLAWLALKDH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctctgctcagggcgagcctgatgatcattgcgatgatggtgggctgcgcgcag
gccaccgcgtcagacggttggagcacctttaaagggcgctttatgaccgaagacggccgc
attcaggataccggcaacaacaacgtcagccataccgaagggcagggctacgcgatgttg
atggcggtctggtacaacgatcgcggcagcttcgacagcctgtggcgctggacccagcag
cacctgaagaacccgcaaaatggcctgttctactggaaatacaatccagccgccgccgat
ccggtgatggacaagaacaatgcctccgacggcgatgtgctgatcgcctgggcgctgctg
aaggccggacagaagtggcaggatcaggcgtatttgcaggcatccgaccgcattcagaag
gcgattgttgaccgcgaagtgatcacctttggtggccagaccgtgatgctgcctggcgtg
cagggctttaataaaaccagctacgtggtgctgaacccgtcctatttcctgttcccggcg
tggcgtgattttgccgcgcgcagtcatctgaaagtctggaccaacctgatcgacagcggg
atggatctgctgggcaagatgcgctttggcgatgccggcctgccggttgactgggtggcg
ctgaacgccgacggcacggtggcaccggccaccgcctggccgccgcgctttagctatgac
gcgatccgcgtgccgctgtatgtctactggtatgacgcgcaaagtctgcagctggtgcct
ttccagcgttactggatgagcttctcccggctgcaaaccccggcgtggattgacgtgatg
agcaataacaaagcgccttacaatatggccggtggtctgctggcggtgcgcgatttgacg
ctgaatcagagcggctatctgacagaccagctggatgccaaagaggattacttctcctcc
agcctgcatctgctggcctggctggcgctgaaagaccactag

DBGET integrated database retrieval system