KEGG   Erwinia billingiae: EbC_44710Help
Entry
EbC_44710         CDS       T01270                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ebi  Erwinia billingiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EbC_44710 (malQ)
Enzymes [BR:ebi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EbC_44710 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4957699..4959780)
Genome map
AA seq 693 aa AA seqDB search
MENNALEQAAREAGIASGFINAHGKPQAIAAETKRDLLQAMGWNNDRRPPARPVPTVRVF
TGGERFALPVNGDGDFSWQFRQESGSEQQGRVNGRMTLALPEPIAAGYHRLTLTQGTQSW
ECRVIVAPKRCFEPEPLLAGKKLWGACVQLYTLRSESNWGIGDFGDLGTLLSQVASRGGA
FVGLNPIHALCPGDPEAASPYSPSSRRWLNIIYIDVAAVPDFKHSEAAQQWWQAAETQHA
LQAVRATDWVDYSAVMALKLKGLRLAYPQFMARKADDAQRQAFARFVKQGGESLWLQAAY
DALYVHLEKETGRAQGWNAWPDAYRNARGPVVRAFCEQQAPEVEFYLWLQWLAETQIERC
YQLSQQAAMPIGLYRDLAVGVVEGGAETWGDGELYCLKASVGAPPDILGPQGQNWDLRPM
DPWAMVNRGYQPFIDLLRSNMIHCGALRIDHVMALLRLWWIPAGETADKGAYVQYPVDDL
LAILALESQRHRCMVIGEDLGTVPVEIVSKLREGGVYSYKVLYFERDAENSFRAPQSYPV
QAMATLTTHDLPTLRSYWQADDLTLGKTLGLYTDDAVLETLYADRAKARQGLLDGLHHYG
CVPVKTAHRAAQLTPAIRRGLQRYVADSASALLGLQPEDWLDMAAPVNVPGTSDQYPNWR
RKLSQTLEAMFADAEVNSLIQDLDKRRRKVSVL
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatgcacttgagcaggcggccagagaggcgggcattgcctccggctttatt
aacgcccacggcaagcctcaggcgattgcggctgaaaccaaacgcgacctgctgcaggcg
atgggctggaacaacgatcggcggccgccggccaggccggtgcccaccgtcagggtgttt
accggcggtgagcgttttgccctgccggttaacggcgacggcgattttagctggcagttt
cgccaggagagcggcagcgagcagcagggcagggtcaacggccgcatgacgctggcgctg
ccggagccgatcgcggcgggctatcaccgtttgacgctcacccagggcacgcagagctgg
gaatgccgggtgattgtcgccccgaaacgctgcttcgaaccggagccgctgctggcgggg
aaaaagctgtggggcgcctgcgtgcagctgtatacgctgcgctcggagagcaactggggc
atcggcgattttggcgatctcggcacgctattgagtcaggtcgcctcacgcggcggcgcg
tttgtcggcctcaacccgatccacgcgctctgtcccggcgatccggaagcggccagcccg
tacagtccttcgtcccgccgctggctgaatattatttatatcgacgtcgctgcggtgccc
gatttcaagcacagcgaggccgcgcagcagtggtggcaggcggcggaaacgcagcatgct
ctgcaggcggtgcgcgccaccgactgggtggattacagcgcggtgatggcactcaagctg
aaggggctgcgtctggcctacccgcaatttatggcgcgcaaggcggatgatgcgcagcgc
caggcgtttgcccgctttgtgaagcaaggtggcgaaagcctgtggttacaggcggcctat
gacgcgctgtatgtccatctggagaaagaaaccggcagggcacagggctggaacgcctgg
ccggacgcttaccgcaacgcgcgcggtccggtggtgcgggcgttttgcgagcagcaggcg
ccggaggtggagttttacctgtggctgcagtggctggccgaaacgcagattgaacgctgt
tatcagctcagccagcaggccgcgatgccgattggcttataccgcgatctggcggtgggc
gtggtggaaggcggcgcggaaacctggggtgatggcgagctgtactgcctgaaagcctcg
gtcggcgcgccgccggacatcctcggtccgcaggggcaaaactgggatttgcggccgatg
gatccctgggcgatggtcaaccggggctatcagccttttatcgatctgctgcgatccaat
atgatccactgcggcgcgctgcggattgatcatgtgatggcgctgctgcgtctgtggtgg
atcccggcgggtgaaaccgccgataagggggcctacgtgcagtacccggttgacgatctg
ctggccattctggcactggaaagtcagcgccaccgctgcatggtgattggcgaagacctg
ggcacggtgccggtggagattgtcagcaagctgcgtgaaggcggcgtttactcctacaaa
gtgctctactttgagcgtgatgcggagaacagcttccgcgcgccgcagtcctatccggtg
caggcgatggcgacgctgaccacccacgatttaccgacgctgcgcagctactggcaggcg
gacgatttaacgctgggtaaaacgctggggctgtacaccgatgacgcggtgctggagacg
ctgtacgccgaccgggcgaaggcccgtcagggcttgctggatggcctgcatcactatggc
tgcgtgccggtgaaaaccgcgcaccgggccgcccaactgacgccggcgatccgtcgtggc
ctgcaacgctatgtggcggacagcgccagcgcgctgctggggctgcaaccggaagactgg
ttggatatggccgcgccggttaacgtgccgggcaccagcgatcagtatccgaactggcga
cgcaagctgtcgcagacgctggaagcgatgtttgccgatgccgaagtgaacagcctgatt
caggatctggataagcgccgcaggaaagtgtcggtcctctga

DBGET integrated database retrieval system