KEGG   Erwinia billingiae: EbC_pEb10201040Help
Entry
EbC_pEb10201040   CDS       T01270                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ebi  Erwinia billingiae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EbC_pEb10201040 (gpmA)
   01230 Biosynthesis of amino acids
    EbC_pEb10201040 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EbC_pEb10201040 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EbC_pEb10201040 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EbC_pEb10201040 (gpmA)
Enzymes [BR:ebi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EbC_pEb10201040 (gpmA)
Exosome [BR:ebi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EbC_pEb10201040 (gpmA)
  Exosomal proteins of melanoma cells
   EbC_pEb10201040 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pEB102:complement(92766..93467)
Genome map
AA seq 233 aa AA seqDB search
MAPSTLILLRHGESQWNRENRFTGWTDVPLTDRGRQEADRAGDVLRDAGLLPDRVFTSVM
TRCVHTVWRVLDRLGRSWTPVDKHWRLNERHYGALQGLNKEAAARMMGAETVRLWRKSFS
GIPPADAGAPAQLRRDPRYSRVALADLPATESLEMTLRRVMPYWQHAVMPQILCGSTVLV
VAHGNTLRALAAFLDGMPHDSLAQLHIPTGVPAVYQMDAAAQVVSRYVLNIKK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccttcaacgctgattctcctgcgccatggcgaaagccagtggaaccgggaaaac
cgttttaccggatggacagacgtgccgctgacggaccgggggcggcaggaggctgaccgg
gccggtgacgtgctgcgggacgcgggcctgctgcccgatcgggtcttcacctcggtgatg
acgcgctgtgttcacacggtctggcgggtgctggaccgtcttggccgcagctggacgccc
gtggacaaacactggcggctgaacgagcggcactacggtgcgctgcaggggctgaacaag
gaagcggctgcccggatgatgggtgcagagaccgtccggctctggcgcaaaagcttcagc
ggcattccccccgcggacgcaggggctccggcgcagctgcgtcgggacccgcgctacagc
cgcgttgcgctggccgacctgcctgcgacggaaagcctggaaatgacgctgcgtcgcgtc
atgccctactggcagcacgccgtgatgccgcagatactctgcggaagtaccgttctggtc
gtggcgcacggcaacacgctgcgcgccctggccgccttcctggacggcatgccacacgac
agcttggcacagttgcatatcccgaccggcgtgccggccgtataccagatggatgcggcc
gcacaggtcgtttcccgttatgttctgaatataaaaaaataa

DBGET integrated database retrieval system