KEGG   Escherichia coli B REL606: ECB_00305Help
Entry
ECB_00305         CDS       T00944                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00360  Phenylalanine metabolism
ebr00362  Benzoate degradation
ebr00620  Pyruvate metabolism
ebr00621  Dioxin degradation
ebr00622  Xylene degradation
ebr00650  Butanoate metabolism
ebr01100  Metabolic pathways
ebr01120  Microbial metabolism in diverse environments
ebr01220  Degradation of aromatic compounds
Module
ebr_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECB_00305 (mhpF)
   00650 Butanoate metabolism
    ECB_00305 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECB_00305 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECB_00305 (mhpF)
   00622 Xylene degradation
    ECB_00305 (mhpF)
   00621 Dioxin degradation
    ECB_00305 (mhpF)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECB_00305 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACT37996
Position
345477..346427
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system