KEGG   Escherichia coli B REL606: ECB_01235Help
Entry
ECB_01235         CDS       T00944                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00260  Glycine, serine and threonine metabolism
ebr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01130  Biosynthesis of antibiotics
ebr01230  Biosynthesis of amino acids
Module
ebr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECB_01235 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECB_01235 (trpB)
Enzymes [BR:ebr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECB_01235 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACT38912
Structure
PDB: 

Jmol
Position
complement(1314816..1316009)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENLDKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagtgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctcaagcgtgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctggggcaggcgttgctggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggtagt
tacgaaaccgcgcactatatgctgggcaccgcagctggcccgcatccttatccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaaccaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgctgatttcatcaatgaaaccaacgtcggcctgattggtgtggagccaggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggtatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtctattaccgatgatgaagcccttgaagccttcaaaacgctgtgc
ctgcacgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgttgaaa
atgatgcgcgaaaacctggataaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system