KEGG   Escherichia coli B REL606: ECB_01237Help
Entry
ECB_01237         CDS       T00944                                 

Gene name
trpD
Definition
(GenBank) bifunctional indole-3-glycerol-phosphate synthase/anthranilate phosphoribosyltransferase
  KO
K13497  anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01130  Biosynthesis of antibiotics
ebr01230  Biosynthesis of amino acids
Module
ebr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECB_01237 (trpD)
Enzymes [BR:ebr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     ECB_01237 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ECB_01237 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 GATase Glycos_trans_3N Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ACT38914
Position
complement(1317383..1318978)
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattctgctgctcgataatatcgactcttttacgtacaacctggcagatcag
ttgcgcagcaatggtcataacgtggtgatttaccgcaaccatattccggcgcagacctta
attgaacgcctggcgacgatgagcaatccggtactgatgctttctcctggccccggtgtg
ccgagcgaagccggttgtatgccggaactcctcacccgcttgcgtggcaagctgcccatt
attggcatttgcctcggacatcaggcaattgtcgaagcttacgggggctatgtcggtcag
gcgggcgaaattcttcacggtaaagcgtcgagcattgaacatgacggtcaggcgatgttt
gccggattaacaaacccgctgccggtggcgcgttatcactcgctggttggcagtaacatt
ccggccggtttaaccatcaacgcccattttaatggcatggtgatggcagtacgtcacgat
gcggatcgcgtttgtggattccagttccatccggaatccattctcaccacccagggcgct
cgcctgctggaacaaacgctggcctgggcgcagcagaaactagagccagccaacacgctg
caaccgattctggaaaaactgtatcaggcgcagacgcttagccaacaagaaagccaccag
ctgttttcagcggtggtgcgtggcgagctgaagccggaacaactggcggcggcgctggtg
agcatgaaaattcgcggtgagcacccgaacgagatcgccggagcagcaaccgcgctactg
gaaaacgccgcgccgttcccgcgcccggattatctgtttgctgatatcgtcggtactggc
ggtgacggcagcaacagtatcaatatttctaccgccagtgcgtttgtcgccgcggcctgt
gggctgaaagtggcgaaacacggcaaccgtagcgtctccagtaaatctggttcgtccgat
ctgctggcggcgttcggtattaatcttgatatgaacgccgataaatcgcgccaggcgctg
gatgagttaggtgtatgtttcctctttgcgccgaagtatcacaccggattccgccacgcg
atgccggttcgccagcaactgaaaacccgcaccctgttcaatgtgctggggccattgatt
aacccggcgcatccgccgctggcgttaattggtgtttatagtccggaactggtgctgccg
attgccgaaaccttgcgcgtgctggggtatcaacgcgcggcggtggtgcacagcggcggg
atggatgaagtttcattacacgcgccgacaatcgttgccgagctgcatgacggcgaaatt
aagagctatcaattgaccgctgaagattttggcctgactccctaccaccaggagcaactg
gcaggcggaacaccggaagaaaaccgtgacattttaacacgcttgttacaaggtaaaggc
gacgccgcccatgaagcagccgtcgctgcgaacgtcgccatgttaatgcgcctgcatggc
catgaagatctgcaagccaatgcgcaaaccgttcttgaggtactgcgcagtggttccgct
tacgacagagttaccgcactggcggcacgagggtaa

DBGET integrated database retrieval system