KEGG   Escherichia coli B REL606: ECB_01237Help
Entry
ECB_01237         CDS       T00944                                 

Gene name
trpD
Definition
bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase (EC:4.1.3.27 2.4.2.18)
Orthology
K13497  
anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
ebr  Escherichia coli B REL606
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECB_01237 (trpD)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECB_01237 (trpD)
Enzymes [BR:ebr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     ECB_01237 (trpD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ECB_01237 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1317383..1318978)
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattctgctgctcgataatatcgactcttttacgtacaacctggcagatcag
ttgcgcagcaatggtcataacgtggtgatttaccgcaaccatattccggcgcagacctta
attgaacgcctggcgacgatgagcaatccggtactgatgctttctcctggccccggtgtg
ccgagcgaagccggttgtatgccggaactcctcacccgcttgcgtggcaagctgcccatt
attggcatttgcctcggacatcaggcaattgtcgaagcttacgggggctatgtcggtcag
gcgggcgaaattcttcacggtaaagcgtcgagcattgaacatgacggtcaggcgatgttt
gccggattaacaaacccgctgccggtggcgcgttatcactcgctggttggcagtaacatt
ccggccggtttaaccatcaacgcccattttaatggcatggtgatggcagtacgtcacgat
gcggatcgcgtttgtggattccagttccatccggaatccattctcaccacccagggcgct
cgcctgctggaacaaacgctggcctgggcgcagcagaaactagagccagccaacacgctg
caaccgattctggaaaaactgtatcaggcgcagacgcttagccaacaagaaagccaccag
ctgttttcagcggtggtgcgtggcgagctgaagccggaacaactggcggcggcgctggtg
agcatgaaaattcgcggtgagcacccgaacgagatcgccggagcagcaaccgcgctactg
gaaaacgccgcgccgttcccgcgcccggattatctgtttgctgatatcgtcggtactggc
ggtgacggcagcaacagtatcaatatttctaccgccagtgcgtttgtcgccgcggcctgt
gggctgaaagtggcgaaacacggcaaccgtagcgtctccagtaaatctggttcgtccgat
ctgctggcggcgttcggtattaatcttgatatgaacgccgataaatcgcgccaggcgctg
gatgagttaggtgtatgtttcctctttgcgccgaagtatcacaccggattccgccacgcg
atgccggttcgccagcaactgaaaacccgcaccctgttcaatgtgctggggccattgatt
aacccggcgcatccgccgctggcgttaattggtgtttatagtccggaactggtgctgccg
attgccgaaaccttgcgcgtgctggggtatcaacgcgcggcggtggtgcacagcggcggg
atggatgaagtttcattacacgcgccgacaatcgttgccgagctgcatgacggcgaaatt
aagagctatcaattgaccgctgaagattttggcctgactccctaccaccaggagcaactg
gcaggcggaacaccggaagaaaaccgtgacattttaacacgcttgttacaaggtaaaggc
gacgccgcccatgaagcagccgtcgctgcgaacgtcgccatgttaatgcgcctgcatggc
catgaagatctgcaagccaatgcgcaaaccgttcttgaggtactgcgcagtggttccgct
tacgacagagttaccgcactggcggcacgagggtaa

DBGET integrated database retrieval system