KEGG   Escherichia coli B REL606: ECB_01237Help
Entry
ECB_01237         CDS       T00944                                 

Gene name
trpD
Definition
bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase (EC:4.1.3.27 2.4.2.18)
Orthology
K13497  
anthranilate synthase/phosphoribosyltransferase [EC:4.1.3.27 2.4.2.18]
Organism
ebr  Escherichia coli B REL606
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ebr01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ebr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1317383..1318978)
Genome map
AA seq 531 aa AA seqDB search
MADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGV
PSEAGCMPELLTRLRGKLPIIGICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMF
AGLTNPLPVARYHSLVGSNIPAGLTINAHFNGMVMAVRHDADRVCGFQFHPESILTTQGA
RLLEQTLAWAQQKLEPANTLQPILEKLYQAQTLSQQESHQLFSAVVRGELKPEQLAAALV
SMKIRGEHPNEIAGAATALLENAAPFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC
GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQALDELGVCFLFAPKYHTGFRHA
MPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAETLRVLGYQRAAVVHSGG
MDEVSLHAPTIVAELHDGEIKSYQLTAEDFGLTPYHQEQLAGGTPEENRDILTRLLQGKG
DAAHEAAVAANVAMLMRLHGHEDLQANAQTVLEVLRSGSAYDRVTALAARG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattctgctgctcgataatatcgactcttttacgtacaacctggcagatcag
ttgcgcagcaatggtcataacgtggtgatttaccgcaaccatattccggcgcagacctta
attgaacgcctggcgacgatgagcaatccggtactgatgctttctcctggccccggtgtg
ccgagcgaagccggttgtatgccggaactcctcacccgcttgcgtggcaagctgcccatt
attggcatttgcctcggacatcaggcaattgtcgaagcttacgggggctatgtcggtcag
gcgggcgaaattcttcacggtaaagcgtcgagcattgaacatgacggtcaggcgatgttt
gccggattaacaaacccgctgccggtggcgcgttatcactcgctggttggcagtaacatt
ccggccggtttaaccatcaacgcccattttaatggcatggtgatggcagtacgtcacgat
gcggatcgcgtttgtggattccagttccatccggaatccattctcaccacccagggcgct
cgcctgctggaacaaacgctggcctgggcgcagcagaaactagagccagccaacacgctg
caaccgattctggaaaaactgtatcaggcgcagacgcttagccaacaagaaagccaccag
ctgttttcagcggtggtgcgtggcgagctgaagccggaacaactggcggcggcgctggtg
agcatgaaaattcgcggtgagcacccgaacgagatcgccggagcagcaaccgcgctactg
gaaaacgccgcgccgttcccgcgcccggattatctgtttgctgatatcgtcggtactggc
ggtgacggcagcaacagtatcaatatttctaccgccagtgcgtttgtcgccgcggcctgt
gggctgaaagtggcgaaacacggcaaccgtagcgtctccagtaaatctggttcgtccgat
ctgctggcggcgttcggtattaatcttgatatgaacgccgataaatcgcgccaggcgctg
gatgagttaggtgtatgtttcctctttgcgccgaagtatcacaccggattccgccacgcg
atgccggttcgccagcaactgaaaacccgcaccctgttcaatgtgctggggccattgatt
aacccggcgcatccgccgctggcgttaattggtgtttatagtccggaactggtgctgccg
attgccgaaaccttgcgcgtgctggggtatcaacgcgcggcggtggtgcacagcggcggg
atggatgaagtttcattacacgcgccgacaatcgttgccgagctgcatgacggcgaaatt
aagagctatcaattgaccgctgaagattttggcctgactccctaccaccaggagcaactg
gcaggcggaacaccggaagaaaaccgtgacattttaacacgcttgttacaaggtaaaggc
gacgccgcccatgaagcagccgtcgctgcgaacgtcgccatgttaatgcgcctgcatggc
catgaagatctgcaagccaatgcgcaaaccgttcttgaggtactgcgcagtggttccgct
tacgacagagttaccgcactggcggcacgagggtaa

DBGET integrated database retrieval system