KEGG   Escherichia coli B REL606: ECB_01519Help
Entry
ECB_01519         CDS       T00944                                 

Gene name
ydfQ-2
Definition
putative lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ebr  Escherichia coli B REL606
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1611718..1612251)
Genome map
AA seq 177 aa AA seqDB search
MNVKIRYSLSAAVLALIAASAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCAQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaatcagatacagcctgtcggccgctgttctggcactgattgccgccagt
gctcctgcccctgacattctcgatcagtttctggatgaaaaagaggggaatcacaccact
gcataccgcgatggctccggcatatggaccatctgtcggggagcaacgatggtggacggt
aaacctgttattccgggaatgaaactgtcgaaggaaaaatgcgcccaggttaacgccatt
gagcgggataaggcgctggcatgggtggagcgcaatataaaagttccactgaccgagcca
cagaaagccggtatcgcgtcattctgtccctataacattggccctggtaagtgttttccg
tcgacgttttataagcggcttaatgccggtgatcgtaaaggcgcatgcgaggcgattcgc
tggtggataaaggacggtggacgtgattgccgcattcgttcaaataattgttacggtcag
gttattcgtcgtgaccaggagagtgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system