KEGG   Escherichia coli B REL606: ECB_01683Help
Entry
ECB_01683         CDS       T00944                                 

Gene name
pheS
Definition
(GenBank) phenylalanyl-tRNA synthetase alpha subunit
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00970  Aminoacyl-tRNA biosynthesis
Module
ebr_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECB_01683 (pheS)
Enzymes [BR:ebr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     ECB_01683 (pheS)
Amino acid related enzymes [BR:ebr01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   ECB_01683 (pheS)
Transfer RNA biogenesis [BR:ebr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECB_01683 (pheS)
 Prokaryotic Type
    ECB_01683 (pheS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: ACT39346
Structure
PDB: 

Jmol
Position
complement(1775226..1776209)
Genome map
AA seq 327 aa AA seqDB search
MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVI
NEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRRIENGGLHPVTRTIDRIESFF
GELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKA
QQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQ
IRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGME
RLTMLRYGVTDLRSFFENDLRFLKQFK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatctcgcagaactggttgccagtgcgaaggcggccattagccaggcgtcagat
gttgccgcgttagataatgtgcgcgtcgaatatttgggtaaaaaagggcacttaaccctt
cagatgacgaccctgcgtgagctgccgccagaagagcgtccggcagctggtgcggttatc
aacgaagcgaaagagcaggttcagcaggcgctgaatgcgcgtaaagcggaactggaaagc
gctgcactgaatgcgcgtctggcggcggaaacgattgatgtctctctgccaggtcgtcgc
attgaaaacggcggtctgcatccggttacccgtaccatcgaccgtatcgaaagtttcttc
ggtgagcttggctttaccgtggcaaccgggccggaaatcgaagacgattatcataacttc
gatgctctgaacattcctggtcaccacccggcgcgcgctgaccacgacactttctggttt
gacactacccgcctgctgcgtacccagacctctggcgtacagatccgcaccatgaaagcc
cagcagccaccgattcgtatcatcgcgcctggccgtgtttatcgtaacgactacgaccag
actcacacgccgatgttccatcagatggaaggtctgattgttgataccaacatcagcttt
accaacctgaaaggcacgctgcacgacttcctgcgtaacttctttgaggaagatttgcag
attcgcttccgtccttcctacttcccgtttaccgaaccttctgcagaagtggacgtcatg
ggtaaaaacggtaaatggctggaagtgctgggctgcgggatggtgcatccgaacgtgctg
cgtaacgttggcatcgacccggaagtttactctggtttcgccttcgggatggggatggag
cgtctgactatgttgcgttacggcgtcaccgacctgcgttcattcttcgaaaacgatctg
cgtttcctcaaacagtttaaataa

DBGET integrated database retrieval system