KEGG   Escherichia coli B REL606: ECB_01687Help
Entry
ECB_01687         CDS       T00944                                 

Gene name
infC
Definition
(GenBank) translation initiation factor IF-3
  KO
K02520  
translation initiation factor IF-3
Organism
ebr  Escherichia coli B REL606
Brite
Translation factors [BR:ebr03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    ECB_01687 (infC)
 Prokaryotic Type
   ECB_01687 (infC)
Mitochondrial biogenesis [BR:ebr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ECB_01687 (infC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1777363..1777797)
Genome map
AA seq 144 aa AA seqDB search
MSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVKEI
KFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELA
VVESFPTKIEGRQMIMVLAPKKKQ
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctgagagaagctctggagaaagcagaagaagccggagtagacttagtcgagatc
agccctaacgccgagccgccggtttgtcgtataatggattacggcaaattcctctatgaa
aagagcaagtcttctaaggaacagaagaaaaagcaaaaagttatccaggttaaggaaatt
aaattccgtcctggtacagatgaaggcgactatcaggtaaaactccgcagcctgattcgc
tttctcgaagagggtgataaagccaaaatcacgctgcgtttccgcggtcgtgagatggcg
caccagcaaatcggtatggaagtgcttaatcgcgtgaaagacgatttgcaagaactggca
gtggtcgaatccttcccaacgaagatcgaaggccgccagatgatcatggtgctcgctcct
aagaagaaacagtaa

DBGET integrated database retrieval system