KEGG   Escherichia coli B REL606: ECB_01708Help
Entry
ECB_01708         CDS       T00944                                 

Gene name
osmE
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K04064  osmotically inducible lipoprotein OsmE
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpA_OmlA DUF4223
Motif
Other DBs
NCBI-ProteinID: ACT39370
Position
complement(1799183..1799521)
Genome map
AA seq 112 aa AA seqDB search
MNKNMAGILSAAAVLTMLAGCTAYDRTKDQFVQPVVKDVKKGMSRAQVAQIAGKPSSEVS
MIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEYDTDPQAAK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatggcaggaattctgagtgcagcggcggtattaaccatgctggcgggt
tgtacggcttatgatcgtaccaaagaccagtttgtacagcctgtggtgaaagacgtcaaa
aaaggcatgagccgggcgcaggttgcacaaattgcgggtaaaccttcgtctgaagtgagc
atgatccatgctcgtggtacttgccagacctacatcctgggtcaacgtgatggtaaagca
gaaacctactttgtcgcgttagatgataccggacatgtcatcaactccggttatcagacc
tgtgctgaatacgacactgatccacaggctgcgaagtaa

DBGET integrated database retrieval system