KEGG   Escherichia coli B REL606: ECB_01714Help
Entry
ECB_01714         CDS       T00944                                 

Gene name
astB
Definition
(GenBank) succinylarginine dihydrolase
  KO
K01484  
succinylarginine dihydrolase [EC:3.5.3.23]
Organism
ebr  Escherichia coli B REL606
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECB_01714 (astB)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.23  N-succinylarginine dihydrolase
     ECB_01714 (astB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(1804181..1805524)
Genome map
AA seq 447 aa AA seqDB search
MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRQAAKQGLLKMKALADAGFPQA
VIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSADT
LDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAANHN
RLGGHYGEPGMQLFVYGREEGNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD
VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNGFMAIEVPATQVSVSDTV
STYLFNSQLLSRDDGSMMLVLPQECREHAGVWGYLNELLAADNPISELKVFDLRESMANG
GGPACLRLRVVLTEEERRAVNPAVMMNDTLFNALNDWVDRYYRDRLTAADLADPQLLREG
REALDVLSQLLNLGSVYPFQREGGGNG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctgggaagttaatttcgacgggctggtagggctgacgcatcattacgctggc
ctgtcgtttggtaatgaagcctctacccgtcaccgttttcaggtgtctaacccgcgacag
gcggcaaaacagggcttactgaaaatgaaagcccttgccgatgcgggattcccccaggcc
gtgatcccgccgcacgagcgtccgtttattccggtgctgcgtcagttgggattcagtggt
agcgatgagcaggtactggaaaaagttgcacgccaggcaccgcactggctttccagcgtc
agttccgcttcgccaatgtgggtagccaatgcggcaacgatcgcgccatctgccgatacg
ctggatggcaaagtgcatctcaccgttgccaacctgaacaataaatttcaccgttcgctg
gaagcgcccgtcactgaatcgctgttaaaagcgatttttaacgacgaagagaaatttagc
gtccattcggcgttgccacaggtagcgttgctcggtgatgagggggcggcaaaccacaat
cgtctcggcggtcattacggtgaaccgggtatgcaactttttgtctacgggcgagaagaa
ggcaatgatacccggccttcccgttatccggcgcgacagactcgcgaagccagcgaggcg
gtggcaaggctgaatcaggtgaatccccaacaggtgattttcgcccagcaaaacccggac
gttatcgaccagggcgtttttcataatgacgtgattgccgtgagtaaccgccaggtgctg
ttttgccaccaacaggcgttcgctcgccagtcacagttactggcaaacctgcgtgcgcgg
gtcaatggttttatggcgatagaagttccggcaactcaggtttccgtgtctgatacggtg
tctacctatctgtttaacagccaactgctgagccgcgatgatggttccatgatgttggtg
ctgcctcaggagtgtcgggaacacgccggagtatggggttatctcaatgaactccttgcc
gctgacaacccgattagcgaactaaaagtctttgatttacgtgaaagcatggcgaatggc
ggcggcccggcgtgcctgcggttgcgggtggtattgacagaagaagaacgccgggcggtg
aatccggcggtgatgatgaacgatacgctgtttaatgcgctcaatgactgggtggatcgt
tactaccgcgatcgccttactgctgccgatctggccgacccgcaattgctgcgcgaaggg
cgggaagcactggatgtattgagccaattactgaatctcggttcggtttatccgttccag
cgcgagggagggggcaatggataa

DBGET integrated database retrieval system