KEGG   Escherichia coli B REL606: ECB_01715Help
Entry
ECB_01715         CDS       T00944                                 

Gene name
astD
Definition
(GenBank) succinylglutamic semialdehyde dehydrogenase
  KO
K06447  succinylglutamic semialdehyde dehydrogenase [EC:1.2.1.71]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00330  Arginine and proline metabolism
ebr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECB_01715 (astD)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.71  succinylglutamate-semialdehyde dehydrogenase
     ECB_01715 (astD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2184
Motif
Other DBs
NCBI-ProteinID: ACT39377
Position
complement(1805521..1806999)
Genome map
AA seq 492 aa AA seqDB search
MTLWINGDWITGQGALRVRRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSLAE
RQVVVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQR
SEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAV
MRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKIL
ALEMGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVA
VSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRTLLAPRLLQSETSLLTP
GIIEMTGVAGVPDEEVFGPLLRVWRYDSFEEAILMANNTRFGLSCGLVSPEREKFDQLLL
EARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLESDSLTLPATL
NPGLDFSDEVVR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactttatggattaacggtgactggataacgggccagggcgcattgcgtgtgaggcgt
aatccggtatcgggcgaggtgttatggcagggcaatgatgccgatgccgctcaggtcgag
caggcttgtcgggcagcccgtgcggcgtttccgcgctgggcgcggctctcattggctgaa
cgtcaggtcgttgtcgaacgctttgccggattgctggaaagcaataaagccgaattaacc
gcgattattgccagagaaacgggtaagccgcgctgggaagcggcaaccgaagtgacggcg
atgatcaataaaatcgcgatatcaattaaggcgtatcacgttcgtaccggcgagcagcgt
agtgaaatgccggacggtgcggcgagcctgcgacatcgcccgcacggcgtgctggcggtg
tttgggccgtataatttccctggtcatttgccgaacggacatatcgttccggcattgctg
gcaggtaacaccattatctttaaacccagcgaactgacaccgtggagtggcgaagcggta
atgcgtttatggcagcaggctggcttgccgccgggcgtactgaatctggtgcagggcggg
cgtgaaacgggtcaggcgctgagtgcgctggaggatctcgacggtttgctgtttaccggt
agcgccaataccggctaccagctgcatcgccagctctccggtcagccggagaaaattctc
gcccttgagatgggcggtaataatccgctaattatcgatgaggtggcggatatcgacgcg
gctgtccatctgaccattcagtcggcgtttgtcacagccgggcaacgctgcacctgcgcc
cgccgtttattgctcaaaagcggagcgcagggcgatgcgtttcttgctcgtctggttgcc
gtcagccagcgattaacgccgggcaactgggatgacgaaccgcagccgtttattggcggg
ctgatttctgaacaggccgcacagcaggtggttactgcctggcagcaactggaagcgatg
ggcggacgaaccctgcttgcgccgcgcttattacaatcagagacatcgttgctgacgccg
gggatcattgaaatgacaggcgttgctggcgtaccagatgaagaggtgttcgggccgctt
ttgcgcgtctggcgttatgattctttcgaggaagcgattctaatggcgaataacactcgc
ttcggactctcttgcggtctggtttcccccgagcgggaaaaattcgatcaactgttgctg
gaggcgcgggcggggattgttaactggaacaaaccgcttactggtgctgccagtaccgcg
ccattcggcggcattggtgcatccggtaaccatcgccccagcgcctggtatgccgcagat
tactgcgcatggcctatggcgagcctggagtcggactcgttaactttgcccgcaacgctt
aaccccgggctggatttttccgatgaggtggtgcgatga

DBGET integrated database retrieval system