KEGG   Escherichia coli B REL606: ECB_01735Help
Entry
ECB_01735         CDS       T00944                                 

Gene name
sppA
Definition
(GenBank) protease IV (signal peptide peptidase)
  KO
K04773  
protease IV [EC:3.4.21.-]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ECB_01735 (sppA)
Peptidases [BR:ebr01002]
 Serine Peptidases
  Family S49: protease IV family
   ECB_01735 (sppA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
1826065..1827921
Genome map
AA seq 618 aa AA seqDB search
MRTLWRFIAGFFKWTWRLLNFVREMVLNLFFIFLVLVGVGIWMQVSGGDSKETASRGALL
LDISGVIVDKPDSSQRFSKLSRQLLGASSDRLQENSLFDIVNTIRQAKDDRNITGIVMDL
KNFAGGDQPSMQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLH
GFATNGLYYKSLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYL
NTVAANRQIPAQQVFPGAQGLLEGLTKTGGDTAKYALENKLVDALASSAEIEKALTKEFG
WSKTDKNYRAISYYDYALKTPADTGDSIGVVFANGAIMDGEETQGNVGGDTTAAQIRDAR
LDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANY
IVANPSTLTGSIGIFGVITTVENSLDSIGVHTDGVSTSPLADVSITRALPPEAQLMMQLS
IENGYKRFITLVADARHSTPEQIDKIAQGHVWTGQDAKANGLVDSLGDFDDAVAKAAELA
KVKQWHLEYYVDEPTFFDKVMDNMSGSVRAMLPDAFQAMLPAPLASVASTVKSESDKLAA
FNDPQNRYAFCLTCANMR
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccctttggcgatttattgccggattttttaaatggacgtggcgtctgctgaat
ttcgtccgtgaaatggtacttaacctgttctttattttcctcgtactggttggtgtgggg
atttggatgcaggtcagtggtggtgattcgaaagaaacggccagtcgtggcgcactgctg
ctggacatttctggtgtgatcgtcgataaacccgacagttctcagcggtttagtaaatta
agccgccagctgcttggtgccagttccgatcgtctgcaggaaaactcactgtttgatatc
gtcaacactattcgccaggcgaaggacgaccgcaatatcaccggtattgtgatggatctg
aaaaacttcgcaggcggcgaccaaccgtctatgcagtacatcggcaaagctctgaaagag
tttcgtgacagcgggaaaccggtttatgccgttggcgagaactacagccaggggcaatat
tatctcgccagtttcgccaataaaatttggctgtcaccgcaaggcgtggtggatttgcac
ggttttgctaccaacggtctgtactacaaatcgttgctggataagctgaaagtttccacc
catgtgttccgcgtgggtacgtataaatctgccgttgaaccgtttattcgtgatgacatg
tcaccggcagcccgcgaagctgacagccgctggattggtgagctgtggcaaaactatctg
aatactgttgccgctaaccggcagatccctgctcagcaggtattccctggcgcgcaaggg
ttgcttgagggtttaaccaaaaccggtggcgataccgcgaaatatgcactggaaaacaag
ctggtcgatgcactggcatcgagtgcggaaatcgaaaaagcactgaccaaagagttcggc
tggagtaagactgataaaaattatcgcgccatcagttattacgattacgcattgaaaacg
ccggcagataccggtgacagcatcggtgtcgtcttcgctaatggcgcaattatggatggc
gaggaaactcaggggaatgttggcggtgataccactgcggcacaaatccgcgacgctcgc
cttgacccgaaagtgaaagcgattgtcctgcgtgttaatagcccaggcggcagcgttacc
gcgtctgaagtgattcgcgctgaactggcagcagcccgggcagcgggtaagcctgtggtt
gtatcgatgggcggcatggcggcatctggtggttactggatttccacgccagctaattac
attgtggctaaccccagcaccctgaccggttctatcggtatcttcggcgtgatcaccacc
gtagaaaatagtctggattcgattggtgttcatactgatggtgtctcaacttcaccgctg
gcggatgtttctatcaccagggcactgccgccggaagcgcagctgatgatgcagttaagc
attgagaatggctataaacgctttatcacgctggttgctgatgcgcgtcattcgacgccg
gagcagattgataaaattgcccagggccacgtctggaccggtcaggatgcaaaagctaac
gggctggtcgatagtctcggggatttcgatgatgcggtcgccaaagcagcagagctggca
aaagtgaaacagtggcatctggaatattacgttgatgaaccgaccttcttcgacaaagtg
atggacaacatgtctggttctgtccgggcaatgttgccagatgcgttccaggccatgtta
cctgcaccgctggcctcggtagcctctaccgttaaaagtgaaagtgacaagctggccgcg
tttaatgacccacaaaaccgttatgcgttttgcctgacctgcgccaacatgcgttaa

DBGET integrated database retrieval system