KEGG   Escherichia coli B REL606: ECB_01762Help
Entry
ECB_01762         CDS       T00944                                 

Gene name
yoaF
Definition
(GenBank) conserved outer membrane protein
  KO
K09712  
uncharacterized protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1854507..1854761)
Genome map
AA seq 84 aa AA seqDB search
MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVSTAQGVSNN
CKLPGGETIDEWALWRRDHPAGEK
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcagttttgttctgccttgcttgctggtcctggctggttgttcaacccct
tctcagccagaagcacctaaaccgccgcagattggtatggcaaatccggcgtcggtctat
tgccagcagaagggcgggacgctcattccagtgtcgacagcgcaaggggtcagcaacaat
tgcaaattaccgggcggtgaaacgattgatgaatgggcattgtggcgacgggaccatccg
gctggtgaaaaataa

DBGET integrated database retrieval system