KEGG   Escherichia coli B REL606: ECB_01768Help
Entry
ECB_01768         CDS       T00944                                 

Gene name
yeaS
Definition
(GenBank) neutral amino-acid efflux system
  KO
K11250  
leucine efflux protein
Organism
ebr  Escherichia coli B REL606
Brite
Transporters [BR:ebr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECB_01768 (yeaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1858699..1859337)
Genome map
AA seq 212 aa AA seqDB search
MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL
AWAGVATLIKTTPILFNIIRYLGAFYLLYLGSKILYATLKGKNNEAKSDEPQYGAIFKRA
LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQ
YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctgaatacggggttctgaattactggacctatctggttggggccatttttatt
gtgttggtgccagggccaaataccctgtttgtactcaaaaatagcgtcagtagcggtatg
aaaggcggttatcttgcggcctgcggtgtatttattggcgatgcggtattgatgtttctg
gcatgggctggagtggcgacattaattaagaccaccccgatattattcaacattatacgt
tatcttggtgcgttttatttgctctatctggggagtaaaattctctacgcgaccctgaag
ggtaaaaataacgaggccaaatccgatgagccccaatacggtgctatttttaaacgcgcg
ttaattttgagcctgactaatccgaaagccattttgttctatgtgtcgtttttcgtacag
tttatcgatgttaatgccccacatacgggaatttcattctttattctggcgacgacgctg
gaactggtgagtttctgctatttgagcttcctgattatttctggtgcttttgtcacgcag
tacatacgtaccaaaaagaaactggctaaagtgggcaactcactgattggtttgatgttc
gtgggtttcgctgcccgactggcgacgctgcaatcctga

DBGET integrated database retrieval system