KEGG   Escherichia coli B REL606: ECB_01770Help
Entry
ECB_01770         CDS       T00944                                 

Gene name
yeaU
Definition
(GenBank) predicted dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00630  Glyoxylate and dicarboxylate metabolism
ebr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECB_01770 (yeaU)
   00650 Butanoate metabolism
    ECB_01770 (yeaU)
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     ECB_01770 (yeaU)
    1.1.1.93  tartrate dehydrogenase
     ECB_01770 (yeaU)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     ECB_01770 (yeaU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACT39431
Position
1860490..1861575
Genome map
AA seq 361 aa AA seqDB search
MMKTMRIAAIPGDGIGKEVLPEGIRVLQAAAERWGFALSFEQMEWASCEYYSHHGKMMPD
DWHEQLSRFDAIYFGAVGWPDTVPDHISLWGSLLKFRREFDQYVNLRPVRLFPGVPCPLA
GKQPGDIDFYVVRENTEGEYSSLGGRVNEGTEHEVVIQESVFTRRGVDRILRYAFELAQS
RPRKTLTSATKSNGLAISMPYWDERVEAMAENYPEIRWDKQHIDILCARFVMQPERFDVV
VASNLFGDILSDLGPACIGTIGIAPSANLNPERTFPSLFEPVHGSAPDIYGKNIANPIAT
IWAGAMMLDFLGNGDERFQQAHNGILAAIEEVIAHGPKTPDMKGNATTPQVADAICKIIL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacgatgcgtattgctgcgatcccgggagacgggattggcaaagaagtcctt
cctgaagggattcgcgtgttacaggctgccgctgagcgctggggcttcgccttgagtttt
gagcaaatggagtgggcgagctgcgagtattacagccatcacggtaaaatgatgccggac
gactggcatgagcaacttagccgtttcgacgccatctattttggtgccgtcggctggccg
gataccgttccggaccatatttcgttgtggggttcgctgctgaaatttcgtcgtgaattc
gaccagtacgtcaacctgcgcccggttcgtctctttcctggcgttccctgcccgctggcg
ggaaaacagcctggcgacatcgatttttacgtggtcagggaaaacaccgaaggcgaatat
tcctcgctcggcggtagagtgaatgaaggtacagagcatgaagtcgtcattcaggaatcg
gtatttacgcgtcgtggtgtcgatcgcattttgcgttatgccttcgaacttgcgcaaagc
cgcccacgtaagacgctaacttctgccactaaatcgaacggtttagccatcagcatgccg
tactgggatgagcgagtggaagcaatggccgagaattacccggagatccgctgggacaag
cagcatattgatattctctgcgcgcgttttgtgatgcagccggaacgattcgatgtggtg
gtggcgtccaatttgtttggcgatatcctttccgatcttggcccggcctgcatcggcacc
attggcattgccccatccgccaacctgaatccggaacgcactttcccgtcgctcttcgag
cctgtccacggttccgcgccggatatctacgggaaaaatattgctaaccctatcgccacg
atttgggccggggcaatgatgctcgattttctcggcaatggcgatgagcgtttccagcaa
gcgcataacggtattctggcagcaattgaagaagtgattgctcacgggccgaaaacacct
gatatgaaaggcaatgccaccacgccacaggttgccgacgcgatttgcaaaattattttg
cgttaa

DBGET integrated database retrieval system