KEGG   Escherichia coli B REL606: ECB_01772Help
Entry
ECB_01772         CDS       T00944                                 

Gene name
yeaW
Definition
(GenBank) predicted 2Fe-2S cluster-containing protein
  KO
K22443  
carnitine monooxygenase subunit [EC:1.14.13.239]
Organism
ebr  Escherichia coli B REL606
Brite
Enzymes [BR:ebr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.239  carnitine monooxygenase
     ECB_01772 (yeaW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1863243..1864367
Genome map
AA seq 374 aa AA seqDB search
MSNLSPDFVLPENFCANPQEAWTIPARFYTDQNAFEHEKENVFAKSWICVAHSSELANAN
DYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDG
NLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFINMDPNATSVEDQLPGLGAKVLEACP
EVHDLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQY
GFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIY
FTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHG
IAHFHNLLAQVFKD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgagccctgactttgtactacccgaaaatttttgcgctaacccgcaagag
gcgtggaccattcctgcccgtttttataccgatcagaacgcgtttgaacacgaaaaagag
aacgtcttcgccaaaagctggatttgcgtcgctcacagcagcgaactggcgaatgccaat
gattatgtgacgcgtgagatcattggcgaaagcatcgtgctggtacgcggtcgtgataag
gttttgcgcgcgttctataacgtgtgtccgcaccgtggtcatcagttgttgagcggtgaa
ggaaaagcaaaaaatgtgattacctgcccgtatcacgcatgggcattcaaactcgatggc
aacctggcccatgcacgtaactgcgaaaacgtcgccaatttcgatagcgacaaagcgcaa
ctggttccggtgcgtctggaagaatatgccggattcgtcttcatcaacatggaccccaac
gccaccagcgtagaagatcaattacccggcctgggcgcgaaagtgctggaagcctgcccg
gaagtccacgatctgaaactggcggcccgctttaccacccgcacgcctgccaactggaag
aacattgtcgataactatctcgagtgctatcactgtggtccggcgcatccaggtttctcc
gactccgtacaggttgatcgttactggcacaccatgcacggtaactggacgctgcaatac
ggtttcgccaaaccgtccgaacagtcgtttaaatttgaagagggtacggatgcggcattc
cacggtttctggctgtggccgtgcacgatgctgaacgtcaccccgatcaaagggatgatg
acggtcatttatgaattcccggtggattctgaaactaccctgcaaaactacgatatttac
ttcaccaatgaagagttaaccgacgagcaaaaatcgctgattgagtggtatcgcgatgtg
ttccgtccggaagatttacgtctggttgaaagcgtacagaaagggctgaaatcgcgtggc
tatcgtggtcaggggcgcatcatggccgacagtagcggtagtggcatttccgaacatggt
atcgcccatttccataatctgctggcgcaggtgtttaaggactaa

DBGET integrated database retrieval system