KEGG   Escherichia coli B REL606: ECB_01776Help
Entry
ECB_01776         CDS       T00944                                 

Gene name
yeaY
Definition
(GenBank) predicted lipoprotein
  KO
K07285  
outer membrane lipoprotein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1868529..1869110)
Genome map
AA seq 193 aa AA seqDB search
MAVQKNVIKGILAGTFALMLSGCVTVPDAIKGSSPTPQQDLVRVMSAPQLYVGQEARFGG
KVVAVQNQQGKTRLEIATVPLDSGARPTLGEPSRGRIYVDVNGFLDPVDFRGQLVTVVGP
ITGAVDGKIGNTPYKFMVMQVTGYKRWHLTQQVIMPPQPIDPWFYGGRGWPYGYGGWGWY
NPGPARVQTVVTE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcaaaagaatgttatcaaaggcatactggcaggtacgtttgcgctaatgctg
agcggttgtgtcactgtgccggacgccattaaaggcagcagtcccacgccgcaacaagat
ttagttcgggtgatgagtgcgccgcagctgtacgttggtcaggaggcacgctttggtggc
aaagtggttgcggtacaaaaccagcaagggaaaacccgcctggaaattgctaccgtaccg
ctggacagcggagccagaccgacgctgggagaaccttctcgcggtcgcatttatgtcgat
gtgaacggttttctggacccggtggatttccgtggacaacttgttacggtagtcgggcca
atcactggtgcggttgacggcaaaatcggcaatacgccctataaatttatggtgatgcaa
gtaacgggttacaaacgttggcatttaacccagcaggtgattatgccgcctcagccgatt
gatccatggttttatggcggtcgtggctggccctatggctacggcggatggggctggtat
aatcccggccccgcgagagtacaaacagttgtaactgaataa

DBGET integrated database retrieval system