KEGG   Escherichia coli B REL606: ECB_01783Help
Entry
ECB_01783         CDS       T00944                                 

Gene name
yeaB
Definition
(GenBank) predicted NUDIX hydrolase
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1874749..1875327
Genome map
AA seq 192 aa AA seqDB search
MEYRSLTLDDFLSRFQLLRPQINRETLNHRQAAVLIPIVRRPQPGLLLTQRSIHLRKHAG
QVAFPGGAVDDTDASVIAAALREAEEEVAIPPSAVEVIGVLPPVDSVTGYQVTPVVGIIP
PDLLYRASEDEVSAVFEMPLAQALHLGRYHPLDIYRRGDSHRVWLSWYEQYFVWGMTACI
IRELALQIGVKP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggaataccgtagcctgacgcttgatgattttttatctcgctttcaacttttgcgcccg
caaattaaccgggaaaccctaaatcatcgtcaggctgccgtgttaatccccatcgtccgt
cgaccgcaaccggggttgttgctgactcagcgttcaattcatctgcgtaaacacgctgga
caagtggcattccctggaggtgcagtcgatgacacggacgcatcagttatcgccgccgcg
ctgcgcgaagctgaagaagaggtcgctataccgccttccgccgttgaagttatcggcgtg
ctgccgcccgtcgatagcgtaactggctatcaggtaaccccagtggtcggcattatcccg
cccgatctgctgtatcgcgccagtgaagatgaagtctcggcggtgtttgaaatgccgctc
gcccaggcattacatctgggtcgttatcaccctttagatatctaccgccgtggcgattca
catcgggtatggctgtcctggtacgaacagtattttgtatggggaatgaccgcatgcata
attcgtgagctggcgctgcaaattggtgtgaaaccctga

DBGET integrated database retrieval system