KEGG   Escherichia coli B REL606: ECB_01785Help
Entry
ECB_01785         CDS       T00944                                 

Gene name
yoaD
Definition
(GenBank) predicted phosphodiesterase
  KO
K21090  c-di-GMP phosphodiesterase [EC:3.1.4.52]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Cellular Processes
  Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    ECB_01785 (yoaD)
Enzymes [BR:ebr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.52  cyclic-guanylate-specific phosphodiesterase
     ECB_01785 (yoaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL CSS-motif MSC stn_TNFRSF12A
Motif
Other DBs
NCBI-ProteinID: ACT39446
Position
1877006..1878604
Genome map
AA seq 532 aa AA seqDB search
MQKAQRIIKTYRRNRMIVCTICALVTLASTLSVRFISQRNLNQQRVVQFANHAVEELDKV
LLPLQAGSEVLLPLIGLPCSVAHLPLRKQAAKLQTVRSIGLVQDGTLYCSSIFGYRNVPV
VDILAELPAPQPLLRLTIDRALIKGSPVLIQWTPAAGSSNAGVMEMINIDLLTAMLLEPQ
LPQISSASLTVDKRHLLYGNGLVDSLPQPEDNENYQVSSQRFPFTINVNGPGATALAWHY
LPTQLPLAVLLSLLVGYIAWLATAYRMSFSREINLGLAQHEFELFCQPLLNARSQQCIGV
EILLRWNNPRQGWISPDVFIPIAEEHHLIVPLTRYVMAETIRQRHVFPMSSQFHVGINVA
PSHFRRGVLIKDLNQYWFSAHPIQQLILEITERDALLDVDYRIARELHRKNVKLAIDDFG
TGNSSFSWLETLRPDVLKIDKSFTAAIGSDAVNSTVTDIIIALGQRLNIELVAEGVETQE
QAKYLRRHGVHILQGYLYAQPMPLRDFPKWLAGSQPPPARHNGHITPIMPLR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagcacaacggatcattaaaacctatcgccgtaatcgaatgattgtttgtacg
atttgcgcactcgttacgctcgcttcgaccctgagcgtgcgatttatttcacagcgtaac
ttaaatcaacaacgggtagtacaattcgccaatcacgctgtagaggaattagataaagta
ctgcttcccctacaggcaggtagcgaagtcttgcttccgctgattggtctgccctgctct
gtcgcccatttgccattacgtaaacaggcggcaaaactccaaactgtgcgatccattggc
ctggtgcaagacggcacactctattgctccagcatttttggttatcgcaatgtgcccgtc
gtggacattctggctgaacttcctgcaccgcaaccacttttacgcctgacgatcgaccgt
gccctgattaaaggcagtccggttttgattcaatggacgcctgcagcgggcagtagcaat
gctggggtcatggagatgattaacatcgacttactgacggcaatgctccttgagccacaa
ctgccgcaaatcagtagcgccagcctgacggtggacaaacggcatttgctctatggtaat
gggctggtagattcccttccgcaacctgaagacaatgaaaactatcaggtttcttcgcaa
cgctttccttttaccattaacgttaatggtccgggggctacggcgctggcatggcactat
cttccaacacaattaccgctggcggtgctgctaagtttactggtgggctacatcgcctgg
ctggcgaccgcttaccggatgagcttttcccgcgaaatcaatctgggcctggcgcaacat
gagttcgaattgttctgtcagcctttgcttaatgcgcgcagccagcaatgtattggtgta
gagattttgctgcgctggaacaatccgcgtcagggctggatttcaccggatgtgtttatt
cctatcgcggaagaacatcatttaattgtgccactgacccgctatgtgatggcagaaacc
attcgtcagcgccatgttttcccgatgagtagtcagtttcatgttggcattaacgtcgca
cccagccattttcgccgtggtgtgctgataaaagatctcaatcagtactggtttagcgct
cacccgattcagcaactgatcctcgaaatcaccgaacgcgatgccttactggatgttgat
tatcggattgcccgcgagctacatcgtaaaaacgtcaaactggcgattgatgacttcggc
accggcaacagttcattttcctggcttgaaacattacgtcctgacgtgctgaaaattgat
aagtcatttaccgcagctataggttctgacgcggttaactcgacggtgaccgatatcatc
atcgcgctggggcaaagactgaatattgaactggtggcggagggcgtggaaacgcaagaa
caggcgaagtatttgcgccgtcatggcgtgcatattttgcaagggtatttgtacgcacag
ccgatgccgctgcgtgattttcccaaatggctggcgggcagccaaccgccgcccgcccgg
cataatggacatatcacgcccattatgccgttacgttaa

DBGET integrated database retrieval system