KEGG   Escherichia coli B REL606: ECB_01789Help
Entry
ECB_01789         CDS       T00944                                 

Gene name
manZ
Definition
(GenBank) mannose-specific enzyme IID component of PTS
  KO
K02796  
PTS system, mannose-specific IID component
Organism
ebr  Escherichia coli B REL606
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:ebr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECB_01789 (manZ)
   00520 Amino sugar and nucleotide sugar metabolism
    ECB_01789 (manZ)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    ECB_01789 (manZ)
Transporters [BR:ebr02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    ECB_01789 (manZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1882465..1883325
Genome map
AA seq 286 aa AA seqDB search
MSEMVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPEN
NEARKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAG
VGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIV
KDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQ
LMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLGL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaatggttgatacaactcaaactaccaccgagaaaaaactcactcaaagtgat
attcgtggcgtcttcctgcgttctaacctcttccagggttcatggaacttcgaacgtatg
caggcactgggtttctgcttctctatggtaccggcaattcgtcgcctctaccctgagaac
aacgaagctcgtaaacaagctattcgccgtcacctggagttctttaacacccagccgttc
gtggctgcgccgattctcggcgtaaccctggcgctggaagaacagcgtgctaatggcgca
gagatcgacgacggtgctatcaacggtatcaaagtcggtttgatggggccgctggctggt
gtaggcgacccgatcttctggggaaccgtacgtccggtatttgcagcactgggtgccggt
atcgcgatgagcggcagcctgttaggtccgctgctgttcttcatcctgtttaacctggtg
cgtctggcaacccgttactacggcgtagcgtatggttactccaaaggtatcgatatcgtt
aaagatatgggtggtggcttcctgcaaaaactgacggaaggggcgtctatcctcggtctg
tttgtcatgggggcattggttaacaagtggacacatgtcaacatcccgctggttgtctct
cgcattactgaccagacgggcaaagaacacgttactactgtccagactattctggaccag
ttaatgccaggcctggtaccactgctgctgacctttgcttgtatgtggctactgcgcaaa
aaagttaacccgctgtggatcatcgttggcttcttcgtcatcggtatcgctggttacgct
tgcggcctgctgggactgtaa

DBGET integrated database retrieval system