KEGG   Escherichia coli B REL606: ECB_01790Help
Entry
ECB_01790         CDS       T00944                                 

Gene name
yobD
Definition
(GenBank) hypothetical protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF986
Motif
Other DBs
NCBI-ProteinID: ACT39451
Position
1883380..1883838
Genome map
AA seq 152 aa AA seqDB search
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN
NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG
VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcacggacctggtactgattcttttcatcgccgcactcctggccttcgcgatc
tacgatcagttcatcatgccccgccgtaatggccccaccctgctggcaattcctttgctc
cggcgtggtcgcatcgatagcgttatcttcgtcggattgattgtcattcttatctataac
aacgtcacgaatcatggtgcgttaataacgacatggttattaagcgcactggctctgatg
ggtttttatatattctggatccgcgttccgaagatcatctttaaacaaaaaggttttttc
ttcgccaatgtctggattgaatatagccgaatcaaagcgatgaacttgtcggaagatggc
gtgttggtgatgcaattagaacagcgtcggctgttaatccgcgttcgaaatatcgacgat
ctggaaaaaatttataagcttctcgtttcaactcaataa

DBGET integrated database retrieval system