KEGG   Escherichia coli B REL606: ECB_01791Help
Entry
ECB_01791         CDS       T00944                                 

Gene name
yebN
Definition
(GenBank) conserved inner membrane protein
Organism
ebr  Escherichia coli B REL606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mntp DUF21
Motif
Other DBs
NCBI-ProteinID: ACT39452
Position
1884267..1884833
Genome map
AA seq 188 aa AA seqDB search
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML
ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM
AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ
ILWTHFHG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcactgctactgttcttcttgcgtttggtatgtcgatggatgcatttgctgca
tcaatcggtaaaggtgccaccctccataaaccgaaattttctgaagcattgcgaaccggc
cttatttttggtgccgtcgaaaccctgacgccgctgatcggctggggaatgggcatgtta
gccagccggtttgtccttgaatggaaccactggattgcgtttgtgctgctgatattcctc
ggcgggcgaatgattattgagggttttcgtggcgcagatgatgaagatgaagagccgcgc
cgtcgacacggtttctggctactggtaaccaccgcgattgccaccagcctggatgccatg
gctgtgggtgttggtcttgctttcctgcaggtcaacattatcgcgaccgcattggccatt
ggttgtgcaaccttgattatgtcaacattagggatgatggttggtcgctttatcggctca
attattgggaaaaaagcggaaattctcggcgggctggtgctgatcggcatcggcgtccag
atcctctggacgcacttccacggttaa

DBGET integrated database retrieval system